1. Search Result
Search Result
Results for "

MET

" in MedChemExpress (MCE) Product Catalog:

1383

Inhibitors & Agonists

4

Screening Libraries

3

Fluorescent Dye

1

Biochemical Assay Reagents

1313

Peptides

18

Inhibitory Antibodies

44

Natural
Products

16

Recombinant Proteins

33

Isotope-Labeled Compounds

9

Antibodies

3

Click Chemistry

6

Oligonucleotides

Targets Recommended:
Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-18309

    c-Met/HGFR VEGFR Cancer
    MET kinase-IN-4 is an orally active Met kinase inhibitor. MET kinase-IN-4 has potent Met kinase inhibitory activity with an IC50 value of 1.9 nM. MET kinase-IN-4 can be used for the research of cancer .
    MET kinase-IN-4
  • HY-P4191A

    CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-P4270

    Neprilysin Neurological Disease
    Met-Arg-Phe-Ala is a peptide. Met-Arg-Phe-Ala also is a potent competitive inhibitor for enkephalin-generating endopeptidase (EGE). Met-Arg-Phe-Ala can be used for the research of neurological disease .
    Met-Arg-Phe-Ala
  • HY-P6440

    Apoptosis Caspase Others
    Met-12 is a small peptide inhibitor of the Fas receptor. Met-12 can inhibit Fas receptor-mediated photoreceptor cell apoptosis, reduce Caspase activation. Met-12 can be used in the research of photoreceptor .
    Met-12
  • HY-P4344

    MetAP Others
    Met-Gly-Pro-AMC is a fluorescent peptide substrate of MetAP2 .
    Met-Gly-Pro-AMC
  • HY-162773

    c-Met/HGFR Cancer
    MET-IN-1 (Compound 13) is an orally active MET inhibitor. MET-IN-1 has antitumor activity .
    MET-IN-1
  • HY-146884

    c-Met/HGFR VEGFR Cancer
    MET kinase-IN-3 (compound 8) is an orally active and potent MET inhibitor, with an IC50 of 9.8 nM. MET kinase-IN-3 shows good and broad-spectrum antiproliferative activity against cancer cell lines .
    MET kinase-IN-3
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-P4196

    Opioid Receptor Neurological Disease
    Met-Enkephalin-Arg-Phe is a naturally occurring heptapeptide with analgesic activity .
    Met-Enkephalin-Arg-Phe
  • HY-139132

    Apoptosis Cancer
    Met-F-AEA is a metabolically stable anandamine analogue. Met-F-AEA inhibits cell growth by activating apoptosis. Met-F-AEA has antitumor activity .
    Met-F-AEA
  • HY-174384

    c-Met/HGFR Apoptosis G-quadruplex Cancer
    MET Transcription-IN-1 (Compound C3) is an orally active MET transcription inhibitor. MET Transcription-IN-1 can efficiently bind and stabilize the G-quadruplex in the MET promoter region, thereby inhibiting c-Met expression. MET Transcription-IN-1 can also overcome drug resistance caused by specific c-Met mutations. MET Transcription-IN-1 is capable of inhibiting tumor cell proliferation, migration, and invasion, as well as inducing cell cycle arrest and apoptosis. MET Transcription-IN-1 has antitumor activity, and can be used in the research of tumors such as non-small cell lung cancer .
    MET Transcription-IN-1
  • HY-P0073
    Tyr-Gly-Gly-Phe-Met-OH
    3 Publications Verification

    MET-Enkephalin; METhionine enkephalin; METenkefalin

    Opioid Receptor Neurological Disease Cancer
    Tyr-Gly-Gly-Phe-Met-OH regulates human immune function and inhibits tumor growth via binding to the opioid receptor.
    Tyr-Gly-Gly-Phe-Met-OH
  • HY-149510

    c-Met/HGFR Apoptosis PDGFR Cancer
    MET/PDGFRA-IN-1 (compound 8c) is a MET and PDGFRA protein inhibitor (IC50: 36 μM for MET). MET/PDGFRA-IN-1 inhibits MET phosphorylation and induces cell apoptosis. MET/PDGFRA-IN-1 inhibits proliferation of MET-positive cells (IC50s: 15.3, 19.0, 22.0, 25.6, 21.0, 31.5 μM for AsPc-1, EBC-1, MKN-45, Mia-Paca-2, HT-29, K562 cells respectively) .
    MET/PDGFRA-IN-1
  • HY-131065

    c-Met/HGFR Cancer
    MET kinase-IN-2 is a potent, selective, orally bioavailable MET kinase inhibitor with an IC50 of 7.4 nM. MET kinase-IN-2 has antitumor activity .
    MET kinase-IN-2
  • HY-129865

    Drug Derivative Neurological Disease
    MET oxalate is s a tryptamine.
    MET oxalate
  • HY-149511

    c-Met/HGFR Apoptosis PDGFR Cancer
    MET/PDGFRA-IN-2 (compound 8h) is a MET and PDGFRA protein inhibitor. MET/PDGFRA-IN-2 induces cell apoptosis. MET/PDGFRA-IN-2 inhibits proliferation of MET-positive cells (IC50s: 9.7, 6.1, 12.0, 11.5, 8.6, 34.4 μM for AsPc-1, EBC-1, MKN-45, Mia-Paca-2, HT-29, K562 cells respectively) .
    MET/PDGFRA-IN-2
  • HY-E70754

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET Y1230A is a mutant of MET. MET Y1230A Recombinant Human Active Protein Kinase is a recombinant MET Y1230A protein that can be used to study MET Y1230A-related functions .
    MET Y1230A Recombinant Human Active Protein Kinase
  • HY-E70756

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET Y1230D is a mutant of MET. MET Y1230D Recombinant Human Active Protein Kinase is a recombinant MET Y1230D protein that can be used to study MET Y1230D-related functions .
    MET Y1230D Recombinant Human Active Protein Kinase
  • HY-E70758

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET Y1235D is a mutant of MET. MET Y1235D Recombinant Human Active Protein Kinase is a recombinant MET Y1235D protein that can be used to study MET Y1235D-related functions .
    MET Y1235D Recombinant Human Active Protein Kinase
  • HY-E70749

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET D1228N is a mutant of MET. MET D1228N Recombinant Human Active Protein Kinase is a recombinant MET D1228N protein that can be used to study MET D1228N-related functions .
    MET D1228N Recombinant Human Active Protein Kinase
  • HY-E70748

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET D1228H is a mutant of MET. MET D1228H Recombinant Human Active Protein Kinase is a recombinant MET D1228H protein that can be used to study MET D1228H-related functions .
    MET D1228H Recombinant Human Active Protein Kinase
  • HY-E70755

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET Y1230C is a mutant of MET. MET Y1230C Recombinant Human Active Protein Kinase is a recombinant MET Y1230C protein that can be used to study MET Y1230C-related functions .
    MET Y1230C Recombinant Human Active Protein Kinase
  • HY-E70752

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET L1195V is a mutant of MET. MET L1195V Recombinant Human Active Protein Kinase is a recombinant MET L1195V protein that can be used to study MET L1195V-related functions .
    MET L1195V Recombinant Human Active Protein Kinase
  • HY-E70757

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET Y1230H is a mutant of MET. MET Y1230H Recombinant Human Active Protein Kinase is a recombinant MET Y1230H protein that can be used to study MET Y1230H-related functions .
    MET Y1230H Recombinant Human Active Protein Kinase
  • HY-E70751

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET G1163R is a mutant of MET. MET G1163R Recombinant Human Active Protein Kinase is a recombinant MET G1163R protein that can be used to study MET G1163R-related functions .
    MET G1163R Recombinant Human Active Protein Kinase
  • HY-E70753

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET M1250T is a mutant of MET. MET M1250T Recombinant Human Active Protein Kinase is a recombinant MET M1250T protein that can be used to study MET M1250T-related functions .
    MET M1250T Recombinant Human Active Protein Kinase
  • HY-E70750

    c-Met/HGFR Cancer
    Mesenchymal-to-epithelial transition (MET) is a receptor tyrosine kinase for hepatocyte growth factor (HGF). MET overactivation is strongly associated with angiogenesis, cellular motility, growth, and invasion. Aberrant MET signaling can drive tumorigenesis in several cancer types through various molecular mechanisms, including MET amplification, MET exon 14 skipping mutation, MET overexpression, and MET fusions. MET F1200I is a mutant of MET. MET F1200I Recombinant Human Active Protein Kinase is a recombinant MET F1200I protein that can be used to study MET F1200I-related functions .
    MET F1200I Recombinant Human Active Protein Kinase
  • HY-RS08346

    Small Interfering RNA (siRNA) Others

    Met Mouse Pre-designed siRNA Set A contains three designed siRNAs for Met gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Met Mouse Pre-designed siRNA Set A
    Met Mouse Pre-designed siRNA Set A
  • HY-RS08345

    Small Interfering RNA (siRNA) Others

    MET Human Pre-designed siRNA Set A contains three designed siRNAs for MET gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    MET Human Pre-designed siRNA Set A
    MET Human Pre-designed siRNA Set A
  • HY-RS08347

    Small Interfering RNA (siRNA) Others

    Met Rat Pre-designed siRNA Set A contains three designed siRNAs for Met gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Met Rat Pre-designed siRNA Set A
    Met Rat Pre-designed siRNA Set A
  • HY-B1836
    Meldonium
    3 Publications Verification

    MET-88; Quaterin

    Mitochondrial Metabolism Cardiovascular Disease Metabolic Disease
    Meldonium (MET-88) functions as a cardioprotective agent by cpmpetetively inhibiting γ-butyrobetaine hydroxylase (BBOX) and carnitine/organic cation transporter type 2 (OCTN2). Meldonium exhibits IC50 values of 34-62 μM for human recombinant BBOX and an EC50 of 21 μM for human OCTN2. Meldonium is a fatty acid oxidation inhibitor .
    Meldonium
  • HY-159627A

    Bacterial Infection
    Met-AMS TEA (compound 50), a sulfamate analogue of methionyl adenylate, is a potent Escherichia coli methionyl-tRNA synthetase (MetRS) inhibitor (IC50 of 7 nM) .
    Met-AMS TEA
  • HY-P3781

    Amyloid-β Neurological Disease
    (Met(O)35)-Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met(O)35)-Amyloid β-Protein (1-42) can yield an oligomer size distribution characteristic of Aβ40. (Met(O)35)-Amyloid β-Protein (1-42) can be used in the research of Alzheimer’s disease (AD) .
    (Met(O)35)-Amyloid β-Protein (1-42)
  • HY-147296

    MET642

    FXR Inflammation/Immunology Cancer
    Omesdafexor (MET642) is an oral FXR agonist. Omesdafexor can improve colitis induced by adoptive T cell transfer,promote intestinal antimicrobial function, barrier function and inhibit inflammation .
    Omesdafexor
  • HY-P3750

    MET-Lys-Bradykinin

    Bradykinin Receptor Cardiovascular Disease Endocrinology
    Methionyl-Lysyl-Bradykinin (Met-Lys-Bradykinin), a Bradykinin (HY-P0206) analogue, is a kinin .
    Methionyl-Lysyl-Bradykinin
  • HY-B1836A
    Meldonium dihydrate
    3 Publications Verification

    MET-88 dihydrate; Quaterin dihydrate

    Mitochondrial Metabolism Cardiovascular Disease Neurological Disease Metabolic Disease
    Meldonium (MET-88) dihydrate functions as a cardioprotective agent by cpmpetetively inhibiting γ-butyrobetaine hydroxylase (BBOX) and carnitine/organic cation transporter type 2 (OCTN2). Mildronate dihydrate exhibits IC50 values of 34-62 μM for human recombinant BBOX and an EC50 of 21 μM for human OCTN2. Meldonium dihydrate is a fatty acid oxidation inhibitor .
    Meldonium dihydrate
  • HY-P4672

    GCGR Metabolic Disease
    (Met(O)27)-Glucagon (1-29) (human, rat, porcine) is a modified glucagon. (Met(O)27)-Glucagon (1-29) (human, rat, porcine) has the same maximum glucose-synthesizing activity in rat hepatocytes as native glucagon, but it is less potent, suggesting a crucial role of methionine in the binding of glucagon to its hepatic receptor .
    (Met(O)27)-Glucagon (1-29) (human, rat, porcine)
  • HY-P3782

    Amyloid-β Others
    (Met(O2)35)-Amyloid β-Protein (1-42) is a peptide .
    (Met(O2)35)-Amyloid β-Protein (1-42)
  • HY-W012159

    H-MET-SER-OH

    Angiotensin-converting Enzyme (ACE) Cardiovascular Disease
    Methionylserine (H-MET-SER-OH) is a methionine- and serine-containing dipeptide. Methionylserine binds to and translocation via intestinal di/tri-peptide transporter 1 (hPEPT1) with a Km value of 0.2 mM. Methionylserine inhibits ACE enzyme activity. Methionylserine can be used in the research of hypension .
    Methionylserine
  • HY-B1836AR

    MET-88 dihydrate (Standard); Quaterin dihydrate (Standard)

    Reference Standards Mitochondrial Metabolism Cardiovascular Disease Neurological Disease Metabolic Disease
    Meldonium (dihydrate) (Standard) is the analytical standard of Meldonium (dihydrate). This product is intended for research and analytical applications. Meldonium (MET-88) dihydrate functions as a cardioprotective agent by cpmpetetively inhibiting γ-butyrobetaine hydroxylase (BBOX) and carnitine/organic cation transporter type 2 (OCTN2). Mildronate dihydrate exhibits IC50 values of 34-62 μM for human recombinant BBOX and an EC50 of 21 μM for human OCTN2. Meldonium dihydrate is a fatty acid oxidation inhibitor .
    Meldonium dihydrate (Standard)
  • HY-18711A

    METatinib anhydrous; c-MET inhibitor 2

    c-Met/HGFR VEGFR Cancer
    SCR-1481B1 (Metatinib anhydrous) is a potent compound that has activity against cancers dependent upon Met activation and also has activity against cancers as a VEGFR inhibitor.
    SCR-1481B1
  • HY-P99250
    Onartuzumab
    1 Publications Verification

    METMAb

    c-Met/HGFR Cancer
    Onartuzumab (MetMAb) is a unique, humanized and affinity-matured monovalent (one-armed) monoclonal antibody against the MET receptor. Onartuzumab potently inhibits HGF binding and receptor phosphorylation and signaling. Onartuzumab has antibody-like pharmacokinetics and antitumor activity .
    Onartuzumab
  • HY-18711

    METatinib free base; c-MET inhibitor 2 free base

    c-Met/HGFR VEGFR Cancer
    SCR-1481B1 free base, also known as Metatinib free base, is a small molecule receptor kinase inhibitor that targets both c-MET and vascular endothelial growth factor receptor 2 (VEGFR2) .
    SCR-1481B1 free base
  • HY-135763

    MET-36

    Free Fatty Acid Receptor Others Endocrinology
    Metabolex-36 is a FFA4 agonist with a pEC50 value of 5.9 and a pEC50 value of less than 4.0 for FFA1.
    Metabolex-36
  • HY-W419331

    DL-METhionyl-DL-METhionine

    JAK mTOR Cancer
    Methionylmethionine (Met-Met) significantly promotes α-s1 casein (αS1-CN) expression in the mammary explants by enhancing intracellular substrate availability and activating JAK2-STAT5 and mTOR-mediated signaling pathways .
    Methionyl-methionine
  • HY-W175543

    Hemoglobin Cardiovascular Disease
    Methoxyurea (Compound 3) is a potential regulator of nitric oxide (NO) donors that acts on hemoglobins such as oxy-hemoglobin (OxyHb) and met-hemoglobin (MetHb). Methoxyurea is promising for research of sickle cell disease (SCD) .
    Methoxyurea
  • HY-B1836S

    MET-88-d3; Quaterin-d3

    Isotope-Labeled Compounds Mitochondrial Metabolism Cardiovascular Disease Metabolic Disease
    Meldonium-d3 is the deuterated form of Meldonium. Meldonium is a cardiovascular protective agent that competitively inhibits BBOX1 and OCTN2. The IC50 value of Mildronate against human recombinant BBOX is 34-62 μM, and the EC50 value against human OCTN2 is 21 μM. Meldonium is a fatty acid oxidation inhibitor .
    Meldonium-d3
  • HY-W012817

    COX Inflammation/Immunology
    Methylhydroquinone is an orally active COX inhibitor with IC50s of 480.7 μM and 52.2 μM for ovine COX-1 and human recombinant COX-2, respectively. Methylhydroquinone has potential DNA damaging effects: 1) inhibiting COX-1 to reduce prostaglandin synthesis and exert anti-inflammatory activity; 2) inducing DNA single-strand breaks. Methylhydroquinone exerts its effects by competitively binding to the active sites of COX-1 (such as Tyr385, Met522) and non-covalent interactions .
    Methylhydroquinone
  • HY-W012817R

    COX Reference Standards Others
    Methylhydroquinone (Standard) is the analytical standard of Methylhydroquinone. This product is intended for research and analytical applications. Methylhydroquinone is an orally active COX inhibitor with IC50s of 480.7 μM and 52.2 μM for ovine COX-1 and human recombinant COX-2, respectively. Methylhydroquinone has potential DNA damaging effects: 1) inhibiting COX-1 to reduce prostaglandin synthesis and exert anti-inflammatory activity; 2) inducing DNA single-strand breaks. Methylhydroquinone exerts its effects by competitively binding to the active sites of COX-1 (such as Tyr385, Met522) and non-covalent interactions[1][2].
    Methylhydroquinone (Standard)
  • HY-P1087

    METorphamide

    Opioid Receptor Cancer
    Adrenorphin is a opioid octapeptide, acting as a potent agonist of μ-opioid receptor, with Ki of 12 nM.
    Adrenorphin

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: