2. Anti-infection
  3. Bacterial
  4. Enterocin K1

Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Enterocin K1

Enterocin K1 Chemical Structure

CAS No. : 2764845-22-7

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Enterocin K1 Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections[1].

In Vitro

Enterocin K1 has antibacterial activity against different Enterococci with MIC values ranging from 0.048 mg/mL to 1.56 mg/mL[1].
Enterocin K1 (0.01、0.1 and 1 mg/mL) shows no significant erythrocyte hemolysis is observed in human whole blood[1].
Enterocin K1 (1 mg/mL; 0-48 h) shows the inhibitory effect of it on bacteriocins after incubation in whole blood and plasma was 2-fold higher in plasma than in saline and 2-fold higher in blood than in plasma[1].
Enterocin K1 (10 μl of 1 mg/mL; 24 h) inhibits most of the bacteriocins with MIC values higher than 25 mg/ml in a cross-resistant manner in the spot-on-lawn assay[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Enterocin K1 Related Antibodies

Cell Viability Assay[1]

Cell Line: bacteriocin
Concentration: 1 mg/mL
Incubation Time: 8, 24, 48 h
Result: Showed that after 8 h, the MIC of bacteriocin in saline was 0.19 mg/mL, and the MIC of bacteriocin in plasma was 0.78 mg/mL. The MIC of bacteriocin was 1.56 mg/mL in blood, 0.39 mg/mL in saline, 1.56 mg/mL in plasma, and 3.125 mg/m in blood after 48 hours.
Molecular Weight

4564.34

Formula

C218H321N53O51S2
CAS No.
Appearance

Solid

Color

white

Sequence

Met-Lys-Phe-Lys-Phe-Asn-Pro-Thr-Gly-Thr-Ile-Val-Lys-Lys-Leu-Thr-Gln-Tyr-Glu-Ile-Ala-Trp-Phe-Lys-Asn-Lys-His-Gly-Tyr-Tyr-Pro-Trp-Glu-Ile-Pro-Arg-Cys
Sequence Shortening

MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 50 mg/mL (10.95 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2191 mL 1.0954 mL 2.1909 mL
5 mM 0.0438 mL 0.2191 mL 0.4382 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2191 mL 1.0954 mL 2.1909 mL 5.4772 mL
5 mM 0.0438 mL 0.2191 mL 0.4382 mL 1.0954 mL
10 mM 0.0219 mL 0.1095 mL 0.2191 mL 0.5477 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Enterocin K1 Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Enterocin K12764845-22-7 EntK1Enterocin K 1Enterocin K-1EntK 1EntK-1BacterialbacteriocinVREinfectionEepenterococciInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Enterocin K1
Cat. No.:
HY-P5203
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.