1. Membrane Transporter/Ion Channel
  2. Potassium Channel
  3. Kaliotoxin

Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Kaliotoxin

Kaliotoxin Chemical Structure

CAS No. : 145199-73-1

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability[1][2].

IC50 & Target

Kd: 20 nM (KCa channel)[1]

In Vitro

Kaliotoxin (KTX) (250 nM) specifically suppressed the whole cell Ca2+-activated K+ current[1].
Kaliotoxin interacts in a one-to-one way with KCa channels with a Kd of 20 nM[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Kaliotoxin facilitates cognitive processes by the blockage of Kv1.1 or Kv1.3 channels[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male Sprague–Dawley rats (280–300 g)[2]
Dosage: 10 ng
Administration: Intracerebroventricular injection
Result: Improved learning but not information consolidation.
Increased the long-term retrieval of an odour-reward association.
Molecular Weight

4149.94

Formula

C171H283N55O49S8

CAS No.
Sequence

Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Ser-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (Disulfide bridge: Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)

Sequence Shortening

GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bridge: Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kaliotoxin
Cat. No.:
HY-P1281
Quantity:
MCE Japan Authorized Agent: