1. GPCR/G Protein
  2. PACAP Receptor
  3. PACAP (6-38), human, ovine, rat

PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

PACAP (6-38), human, ovine, rat

PACAP (6-38), human, ovine, rat Chemical Structure

CAS No. : 143748-18-9

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of PACAP (6-38), human, ovine, rat:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE PACAP (6-38), human, ovine, rat

View All PACAP Receptor Isoform Specific Products:

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.

IC50 & Target

IC50: 30 nM (PACAP type I receptor), 600 nM (PACAP type II receptor VIP1), 40 nM (PACAP type II receptor VIP2)[1]

Cellular Effect
Cell Line Type Value Description References
CHO IC50
56.7 nM
Compound: 81
Displacement of [125I]Ac-PACAP27 from human recombinant PAC1 receptor expressed in CHO cells by gamma- counter
Displacement of [125I]Ac-PACAP27 from human recombinant PAC1 receptor expressed in CHO cells by gamma- counter
[PMID: 19413310]
In Vitro

An increase of dopamine (DA) content by HPLC analysis and/or cell proliferation identified by MTT assay by Dexamethasone (DEX) is also observed which can be inhibited by PACAP (6-38) at concentration sufficient to block PACAP type 1 (PAC1) receptor. Pretreatment with PAC1 receptor antagonist PACAP (6-38) at 0.1 or 1 μM for 2 h significantly blocks this increase of DA content by 1 μM DEX. The MTT assay shows that DEX increases cell proliferation. Moreover, this action is also inhibited by the pre-incubation of PACAP (6-38). PACAP (6-38) at 1μM shows no effect on DA content and cell proliferation for 24 h. However, PACAP (6-38) at 0.3 μM has been mentioned to reduce the spontaneous tyrosine hydroxylase (TH) accumulation in differentiated retinal cultured cells for 5 days[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Intravesical administration of the PAC1 receptor antagonist, PACAP (6-38) (300 nM), significantly (p≤0.01) increases intercontraction interval (2.0-fold) and void volume (2.5-fold) in NGF-OE mice. Intravesical instillation of PACAP (6-38) also decreases baseline bladder pressure in NGF-OE mice. Intravesical administration of PACAP (6-38) (300 nM) significantly (p≤0.01) reduces pelvic sensitivity in NGF-OE mice but is without effect in WT mice[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4024.74

Formula

C182H300N56O45S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

Sequence Shortening

FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : ≥ 66.67 mg/mL (16.57 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2485 mL 1.2423 mL 2.4846 mL
5 mM 0.0497 mL 0.2485 mL 0.4969 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
Cell Assay
[2]

PC12 cells (5×104 cells per well) are deposited in a 96-well flat-bottom culture plate. Cells are incubated with PACAP(6-38) (0.1 and 1.0 μM) for 2 h before the addition of Dexamethasone (DEX, 1 μM). Cells are harvested at 24 h later of treatment. At regular intervals after the additional treatments, 100 μL of 0.2 mg/mL MTT is added per each well, and cells are incubated for 3 h at 37°C. After incubation, the MTT reagent is discarded, and 100 μL of DMSO is then added. The experiment is performed at room temperature for 20 min. The absorbance is then measured with SPECTRA max 340PC ELISA reader at the wavelength of 570 nm[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Administration
[3]

Mice[3]
Two groups of mice are evaluated: WT mice receiving intravesical administration of vehicle (0.9% saline) and PACAP (6-38) (300 nM) (n=8) and NGF-OE mice receiving intravesical administration of vehicle (0.9% saline) and PACAP (6-38) (300 nM) (n=8). For intravesical administration of PACAP (6-38), mice are anesthetized with 2% isoflurane and PACAP (6-38) (<1.0 mL) is injected through the bladder catheter; the animals are maintained under anesthesia to prevent expulsion of PACAP (6-38) via a voiding reflex. In this procedure, PACAP (6-38) remains in the bladder for 30 min at which time, the drug is drained, the bladder washed with saline and animals recover from anesthesia for 20 min before experimentation[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2485 mL 1.2423 mL 2.4846 mL 6.2116 mL
5 mM 0.0497 mL 0.2485 mL 0.4969 mL 1.2423 mL
10 mM 0.0248 mL 0.1242 mL 0.2485 mL 0.6212 mL
15 mM 0.0166 mL 0.0828 mL 0.1656 mL 0.4141 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PACAP (6-38), human, ovine, rat
Cat. No.:
HY-P0220
Quantity:
MCE Japan Authorized Agent: