2. Anti-infection Immunology/Inflammation
  3. CMV PD-1/PD-L1
  4. VIPhyb

VIPhyb is a vasoactive intestinal polypeptide (VIP) receptor antagonist. VIPhyb can inhibit VIP signaling, increase T-cell immunity and downregulate PD1. VIPhyb can inhibit cancer cell proliferation. VIPhyb can reduce inflammatory cytokine expression. VIPhyb can enhance viral clearance. VIPhyb can be used for the researches of cancer, infection and inflammation and immunology, such as non-small cell lung cancer (NSCLC), cytomegalovirus infection and colitis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

VIPhyb

VIPhyb Chemical Structure

CAS No. : 125093-93-8

Size Price Stock Quantity
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

VIPhyb Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

VIPhyb is a vasoactive intestinal polypeptide (VIP) receptor antagonist. VIPhyb can inhibit VIP signaling, increase T-cell immunity and downregulate PD1. VIPhyb can inhibit cancer cell proliferation. VIPhyb can reduce inflammatory cytokine expression. VIPhyb can enhance viral clearance. VIPhyb can be used for the researches of cancer, infection and inflammation and immunology, such as non-small cell lung cancer (NSCLC), cytomegalovirus infection and colitis[1][2][3][4].

In Vitro

VIPhyb shows an IC50 of 500 nM against NCI-H1299 cells[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

VIPhyb Related Antibodies
In Vivo

VIPhyb (10 μg/mouse, s.c., daily for 1 week starting the day prior to infection) enhances survival, viral clearancen in murine cytomegalovirus (mCMV)-infected C57BL/6 and BALB/c mice[2].
VIPhyb (0.1-1 μM, i.p., daily for 11 days) reduces inflammation in dextran sodium sulfate (DSS)-induced colitis mice models[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Murine cytomegalovirus (mCMV) -infected C57BL/6 and BALB/c mice[2]
Dosage: 10 μg/mouse
Administration: Subcutaneously injection, daily for 1 week starting the day prior to infection
Result: Prolonged survival of mice.
Had less inflammation and tissue damage in the liver.
Decreased intranuclear viral inclusions, inflammatory leukocytes, necrosis, and CMV-infected giant cells.
Increased the numbers of effector/memory CD8+ T-cells and mature NK cells were.
Prevented the up-regulation of PD-L1.
Increased CD80, CD86, and MHC-II expression.
Increased numbers of IFN-γ- and TNF-α-expressing NK cells and T-cells.
Decreased the percentage of Treg cells and levels of serum VEGF.
Animal Model: Dextran sodium sulfate (DSS)-induced colitis mice models[3]
Dosage: 0.1 and 1 μM
Administration: Intraperitoneally injection, daily for 11 days
Result: Led to a significant reduction of weight loss percentage and bloody diarrhea.
Reduced colonic weight/length ratio.
Decreased expression of IL-1, TNF-α, and IL-6.
Molecular Weight

3467.06

Formula

C154H257N49O40S
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Sequence Shortening

KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (28.84 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2884 mL 1.4421 mL 2.8843 mL
5 mM 0.0577 mL 0.2884 mL 0.5769 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 99.73%

SDS (252 KB)

COA (256 KB) RP-HPLC (245 KB) MS (68 KB)

Handling Instructions (2659 KB)
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2884 mL 1.4421 mL 2.8843 mL 7.2107 mL
5 mM 0.0577 mL 0.2884 mL 0.5769 mL 1.4421 mL
10 mM 0.0288 mL 0.1442 mL 0.2884 mL 0.7211 mL
15 mM 0.0192 mL 0.0961 mL 0.1923 mL 0.4807 mL
20 mM 0.0144 mL 0.0721 mL 0.1442 mL 0.3605 mL
25 mM 0.0115 mL 0.0577 mL 0.1154 mL 0.2884 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

VIPhyb Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

VIPhyb125093-93-8CMVPD-1/PD-L1CytomegalovirusPD-1/Programmed death-ligand 1VIPVirusNSCLCPD1ColitisNCI-H1299Inhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VIPhyb
Cat. No.:
HY-P5005
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.