1. Anti-infection
  2. Bacterial
  3. β-defesin 1 (pig) (TFA)

β-defesin 1 (pig) (TFA)  (Synonyms: pBD-1 TFA)

Cat. No.: HY-P2289A Purity: 99.11%
Handling Instructions Technical Support

β-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-defesin 1 (pig) (TFA)

β-defesin 1 (pig) (TFA) Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of β-defesin 1 (pig) (TFA):

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs[1].

IC50 & Target

IC50: bacterial[1]

In Vitro

In a northern blot analysis, β-defesin 1 (pig) TFA mRNA only expresses in ongue epithelial tissues from 4-5 week old pigs[1].
In RT-PCR analysis, β-defesin 1 (pig) TFA message throughout the epithelia of the respiratory (from nasal septum to lung) and gastrointestinal (from esophagus to rectum) tracts. In addition, it is detected in thymus, spleen, lymph node, brain, liver, kidney, urinary bladder, testis, skin, heart, muscle, bone marrow, alveolar macrophages, peripheral blood neutrophils and the umbilical cord. The only cells evaluated that does not express β-defesin 1 (pig) TFA are peripheral blood mononuclear cells[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

5532.56

Formula

C180H313N59O50S9.10C2HF3O2

Appearance

Solid

Color

White to off-white

Sequence

Met-Arg-Leu-His-Arg-Leu-Leu-Leu-Val-Phe-Leu-Leu-Met-Val-Leu-Leu-Pro-Val-Pro-Gly-Leu-Leu-Lys-Asn-Ile-Gly-Asn-Ser-Val-Ser-Cys-Leu-Arg-Asn-Lys-Gly-Val-Cys-Met-Pro-Gly-Lys-Cys-Ala-Pro-Lys-Met-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Met-Pro-Gln-Val-Lys-Cys-Cys-Lys-Arg-Lys

Sequence Shortening

NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (18.07 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : 25 mg/mL (4.52 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1807 mL 0.9037 mL 1.8075 mL
5 mM 0.0361 mL 0.1807 mL 0.3615 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O / DMSO 1 mM 0.1807 mL 0.9037 mL 1.8075 mL 4.5187 mL
DMSO 5 mM 0.0361 mL 0.1807 mL 0.3615 mL 0.9037 mL
10 mM 0.0181 mL 0.0904 mL 0.1807 mL 0.4519 mL
15 mM 0.0120 mL 0.0602 mL 0.1205 mL 0.3012 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-defesin 1 (pig) (TFA)
Cat. No.:
HY-P2289A
Quantity:
MCE Japan Authorized Agent: