1. JAK/STAT Signaling Protein Tyrosine Kinase/RTK Metabolic Enzyme/Protease Membrane Transporter/Ion Channel Neuronal Signaling Immunology/Inflammation MAPK/ERK Pathway Stem Cell/Wnt
  2. EGFR MMP Calcium Channel NOD-like Receptor (NLR) ERK p38 MAPK
  3. Candidalysin

Candidalysin is a cytolytic peptide toxin secreted by the fungus Candida albicans. Candidalysin drives epithelial immune responses by activating the EGFR-MAPK signaling pathway, inducing MMP expression and calcium influx, and regulating the c-Fos transcription factor and MKP1 via p38 MAPK and ERK1/2 respectively. Candidalysin is essential for mucosal and systemic infections, activating NLRP3 to promote inflammatory responses, neutrophil recruitment, and Th17 immunity. Candidalysin activates LDH causing membrane damage and exhibiting cytotoxicity

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Candidalysin

Candidalysin Chemical Structure

CAS No. : 1906866-53-2

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Candidalysin is a cytolytic peptide toxin secreted by the fungus Candida albicans. Candidalysin drives epithelial immune responses by activating the EGFR-MAPK signaling pathway, inducing MMP expression and calcium influx, and regulating the c-Fos transcription factor and MKP1 via p38 MAPK and ERK1/2 respectively. Candidalysin is essential for mucosal and systemic infections, activating NLRP3 to promote inflammatory responses, neutrophil recruitment, and Th17 immunity. Candidalysin activates LDH causing membrane damage and exhibiting cytotoxicity[1][2][3][4]

In Vitro

Candidalysin (3-70 μM, 2 h) induces phosphorylation of EGFR at Y1068 and Y845 in TR146 cells in a dose-dependent manner[1].
Candidalysin (3-70 μM, 2 h-24 h) induces immune response in TR146 cells that are mediated by MMP and calcium influx[1].
Candidalysin (1.5-70 μM, 24 h) induces the release of LDH in A431 vaginal epithelial cells in a dose-dependent manner[2].
Candidalysin (1.5-70 μM, 24 h) upregulates the expression levels of proinflammatory cytokines IL-1α, IL-1β, G-CSF, GM-CSF, IL-6 and IL-8 secreted by A431 vaginal epithelial cells[2].
Candidalysin (10-50 μM, 2 h) activates NLRP3 inflammasome and specifically stimulates bone marrow-derived macrophages (BMDM) to secrete IL-1β[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis[1]

Cell Line: TR146 cells
Concentration: 3, 15, 70 μM
Incubation Time: 2 h
Result: Up-regulated the protein levels of pEGFR Y1068 and pEGFR Y845.

Western Blot Analysis[3]

Cell Line: BMDM
Concentration: 10, 50 μM
Incubation Time: 2 h
Result: Up-regulated the protein levels of IL-1β.
In Vivo

Candidalysin (wild-type C. albicans infection) (107 cfu/mL, sub-lingually for 75 min, once) induces pEGFR Y1068 phosphorylation in the mouse tongue tissue of the oropharyngeal candidiasis (OPC) model[1].
Candidalysin (wild-type C. albicans infection) (5×108 cfu/ml, Intravaginally inoculated, once) induces neutrophil recruitment and mucosal damage in the vulvovaginal candidiasis (VVC) mouse model[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Murine OPC model (female Balb/c mice 22-25 g)[1]
Dosage: 107 cfu/ml C. albicans yeast culture
Administration: Sub-lingually for 75 min, once
Result: Compared with those lacking the candidalysin parent gene ECE1 (ece1Δ/Δ) or the candidalysin-encoding region (ece1Δ/Δ+ECE1Δ184-279), wild-type (WT) C. albicans infection induced lower levels of pEGFR Y1068 in tongue tissues.
Animal Model: Murine VVC model (female 6-8 weeks old C57BL/6 mice)[2]
Dosage: 5×108 cfu/ml C. albicans, 10 μL of the standardized blastoconidial cell suspension, generating an inoculum size of 5×106 blastoconidia.
Administration: Intravaginally inoculated, once
Result: Increased fungal burden.
Increased LDH activity.
Molecular Weight

3310.11

Formula

C153H266N38O38S2

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Ser-Ile-Ile-Gly-Ile-Ile-Met-Gly-Ile-Leu-Gly-Asn-Ile-Pro-Gln-Val-Ile-Gln-Ile-Ile-Met-Ser-Ile-Val-Lys-Ala-Phe-Lys-Gly-Asn-Lys

Sequence Shortening

SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 25 mg/mL (7.55 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : 25 mg/mL (7.55 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3021 mL 1.5105 mL 3.0210 mL
5 mM 0.0604 mL 0.3021 mL 0.6042 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.38%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO / H2O 1 mM 0.3021 mL 1.5105 mL 3.0210 mL 7.5526 mL
5 mM 0.0604 mL 0.3021 mL 0.6042 mL 1.5105 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Candidalysin
Cat. No.:
HY-P10408
Quantity:
MCE Japan Authorized Agent: