1. GPCR/G Protein
  2. GnRH Receptor
  3. Prolactin Releasing Peptide (1-31), human

Prolactin Releasing Peptide (1-31), human 

Cat. No.: HY-P1520 Purity: 99.51%
Handling Instructions Technical Support

Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Prolactin Releasing Peptide (1-31), human

Prolactin Releasing Peptide (1-31), human Chemical Structure

CAS No. : 215510-22-8

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Prolactin Releasing Peptide (1-31), human:

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis[1][2].

In Vitro

Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Prolactin Releasing Peptide (1-31) (human) (ICV, 5 nM) increases plasma FSH, total plasma testosterone and significantly increased the release of LHRH from hypothalamic explants in vitro[2].
Prolactin Releasing Peptide (1-31) (human) (ICV, 100 nM) increases the hypothalanic peptides involved in the control of pituitary hormone release, vasoactive intestinal peptide (VIP) and galanin but had no effect on orexin A secretion[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3664.15

Formula

C160H252N56O42S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2

Sequence Shortening

SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (27.29 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2729 mL 1.3646 mL 2.7291 mL
5 mM 0.0546 mL 0.2729 mL 0.5458 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References
Animal Administration
[1]

Rats[1]

Groups of rats are injected with either Prolactin Releasing Peptide (1-31) 5 nM or saline. Prolactin Releasing Peptide (1-31), human is dissolved in saline is administered in a total volume of 10 μL. Animals are habituated to the injection procedures by three ICV injections prior to the study to minimize stress in the animals. At 10, 20, 60 minutes following injection, rats are decapitated and trunk blood collected into plastic tubes[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2729 mL 1.3646 mL 2.7291 mL 6.8229 mL
5 mM 0.0546 mL 0.2729 mL 0.5458 mL 1.3646 mL
10 mM 0.0273 mL 0.1365 mL 0.2729 mL 0.6823 mL
15 mM 0.0182 mL 0.0910 mL 0.1819 mL 0.4549 mL
20 mM 0.0136 mL 0.0682 mL 0.1365 mL 0.3411 mL
25 mM 0.0109 mL 0.0546 mL 0.1092 mL 0.2729 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin Releasing Peptide (1-31), human
Cat. No.:
HY-P1520
Quantity:
MCE Japan Authorized Agent: