1. Neuronal Signaling Apoptosis
  2. Amyloid-β Apoptosis
  3. β-Amyloid (1-40) (rat)

β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD). β-Amyloid (1-40) (rat) increases 45Ca2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (1-40) (rat)

β-Amyloid (1-40) (rat) Chemical Structure

CAS No. : 144409-98-3

Size Price Stock Quantity
1 mg In-stock
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products

1 Publications Citing Use of MCE β-Amyloid (1-40) (rat)

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD). β-Amyloid (1-40) (rat) increases 45Ca2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease[1][2].

In Vitro

β-Amyloid (1-40) (rat) (1 μM; 1 h) increases 45Ca2+ influx and elevates Ca2+ in cortical synaptosomes[1].
β-Amyloid (1-40) (rat) (3 nM) induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield and induces apoptosis[2].

β-Amyloid Aggregation Guidelines (Following is our recommended protocol. This protocol only provides a guideline, and should be modified according to your specific needs).
1. Solid Aβ peptide is dissolved in cold hexafluoro-2-propanol (HFIP). The peptide is incubated at room temperature for at least 1 h to establish monomerization and randomization of structure.
2. The HFIP is removed by evaporation, and the resulting peptide is stored as a film at -20 or -80 °C.
3. The resulting film is dissolved in anhydrous DMSO at 5 mM and then dilutes into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution is age 48 h at 4-8 °C. The sample is then centrifuged at 14000g for 10 min at 4-8 °C; the soluble oligomers are in the supernatant. The supernatant is diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

β-Amyloid (1-40) (rat) (1.7 mg; ICV, for 7 d; swiss and C57BL/6 mice) induces the learning and memory deficits in mice[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Swiss and C57BL/6 mice[3]
Dosage: 1.7 mg
Administration: Intracerebroventrical injection; for 7 days
Result: Presented spatial learning and memory impairments.
Molecular Weight

4233.76

Formula

C190H291N51O57S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Sequence Shortening

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*The compound is unstable in solutions, freshly prepared is recommended.

Solvent & Solubility
In Vitro: 

DMSO : 50 mg/mL (11.81 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2362 mL 1.1810 mL 2.3620 mL
5 mM 0.0472 mL 0.2362 mL 0.4724 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2362 mL 1.1810 mL 2.3620 mL 5.9049 mL
5 mM 0.0472 mL 0.2362 mL 0.4724 mL 1.1810 mL
10 mM 0.0236 mL 0.1181 mL 0.2362 mL 0.5905 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid (1-40) (rat)
Cat. No.:
HY-P1387
Quantity:
MCE Japan Authorized Agent: