1. Immunology/Inflammation
  2. MHC
  3. TpD

TpD is a chimeric T-helper epitope. TpD has a special site that cathepsin can cut. Immunization with TpD produces a strong antibody response. TpD promotes long-term CD4 immune responses in animals and humans. TpD binds well to many human MHC class II types, mainly HLA-DRB1. It also binds some other HLA alleles like DRB3, DRB4, DRB5, DP, and DQ. TpD can be used to improve the immune response of peptide vaccines.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

TpD

TpD Chemical Structure

CAS No. : 1273551-45-3

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All MHC Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

TpD is a chimeric T-helper epitope. TpD has a special site that cathepsin can cut. Immunization with TpD produces a strong antibody response. TpD promotes long-term CD4 immune responses in animals and humans. TpD binds well to many human MHC class II types, mainly HLA-DRB1. It also binds some other HLA alleles like DRB3, DRB4, DRB5, DP, and DQ. TpD can be used to improve the immune response of peptide vaccines[1].

Molecular Weight

3464.21

Formula

C158H264N38O42S3

CAS No.
Sequence

Ile-Leu-Met-Gln-Tyr-Ile-Lys-Ala-Asn-Ser-Lys-Phe-Ile-Gly-Ile-Pro-Met-Gly-Leu-Pro-Gln-Ser-Ile-Ala-Leu-Ser-Ser-Leu-Met-Val-Ala-Gln

Sequence Shortening

ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TpD
Cat. No.:
HY-P11090
Quantity:
MCE Japan Authorized Agent: