LEAP-2  (Synonyms: Human liver expressed antimicrobial peptide-2)

LEAP-2 (Human liver expressed antimicrobial peptide-2) is a GHS-R1a antagonist, with an IC₅₀ of 6.0 nM. LEAP-2 suppresses the orexigenic effect of ghrelin. LEAP-2 attenuates ghrelin-induced growth hormone (GH) release and reduces basal food intake. LEAP-2 exhibits antimicrobial activity against microbial model organisms. LEAP-2 can be used for the study of obesity and infection^[1][2].

LEAP-2 (1.563-100 μg/mL, 24 h) exhibits selective antimicrobial activity against Vibrio vulnificus, Vibrio alginolyticus, Vibrio anguillarum, Aeromonas hydrophila, and Staphylococcus aureus, with MIC values of 50 μg/mL, 100 μg/mL, 12.5 μg/mL, 12.5 μg/mL, and 100 μg/mL respectively^[3].
LEAP-2 (1-10 μg/mL, 12 h) induces iNOS activity in barbel steed monocytes/macrophages (MO/MΦ)^[3].
LEAP-2(1-10 μg/mL, 12 h) induces respiratory burst in barbel steed MO/MΦ^[3].
LEAP-2 (1-10 μg/mL, 12 h) upregulates the expression of pro-inflammatory cytokines IFN-γ, TNF-α, and IL-1β in barbel steed MO/MΦ^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

LEAP2 (0.72-360 nmol/kg, i.p., once) dose-dependently attenuates ghrelin-induced growth hormone (GH) release in mice^[1].
LEAP2 (3 μmol/kg, s.c., once) completely abolishes ghrelin-induced food intake in mice^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4581.27

C₁₉₁H₃₁₆N₆₄O₅₇S₅

1683582-94-6

Solid

White to off-white

Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu (Disulfide bridge:Cys17-Cys28;Cys23-Cys33)

MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE (Disulfide bridge:Cys17-Cys28;Cys23-Cys33)

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

• [1]. Ge X, et al. LEAP2 Is an Endogenous Antagonist of the Ghrelin Receptor. Cell Metab. 2018 Feb 6;27(2):461-469.e6.  [Content Brief]

  [2]. Krause A, et al. Isolation and biochemical characterization of LEAP-2, a novel blood peptide expressed in the liver. Protein Sci. 2003 Jan;12(1):143-52.  [Content Brief]

  [3]. Chen J, et al. Host defense peptide LEAP-2 contributes to monocyte/macrophage polarization in barbel steed (Hemibarbus labeo). Fish Shellfish Immunol. 2019 Apr;87:184-192. doi: 10.1016/j.fsi.2019.01.015  [Content Brief]