2. Membrane Transporter/Ion Channel
  3. Potassium Channel
  4. Vm24-toxin TFA

Vm24-toxin TFA  (Synonyms: Vaejovis mexicanus peptide 24 TFA)

Cat. No.: HY-P5917A
Handling Instructions Technical Support

Vm24-toxin (Vaejovis mexicanus peptide 24) TFA, a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin TFA shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin TFA folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin TFA attenuates the CD4+ effector memory T cell response to T cell receptor (TCR) stimulation.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Vm24-toxin TFA Chemical Structure

Vm24-toxin TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Vm24-toxin TFA:

Vm24-toxin TFA Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Vm24-toxin (Vaejovis mexicanus peptide 24) TFA, a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin TFA shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin TFA folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin TFA attenuates the CD4+ effector memory T cell response to T cell receptor (TCR) stimulation[1][2].

IC50 & Target[1]

Kv1.3

3 pM (Kd)

Molecular Weight

3863.59 (free base)

Synonyms

Vaejovis mexicanus peptide 24 TFA

Formula

C157H253N51O45S9.xC2HF3O2
Appearance

Solid

Sequence

Ala-Ala-Ala-Ile-Ser-Cys-Val-Gly-Ser-Pro-Glu-Cys-Pro-Pro-Lys-Cys-Arg-Ala-Gln-Gly-Cys-Lys-Asn-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-Lys-Cys-Tyr-Tyr-Cys-NH2 (Disulfide bridge: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36)
Sequence Shortening

AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC-NH2 (Disulfide bridge: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Vm24-toxin TFA Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Vm24-toxinVaejovis mexicanus peptide 24Vaejovis mexicanus peptide24Vaejovis mexicanus peptide-24Potassium ChannelKcsA36-residue peptideKv1.3 BlockerT cell receptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Vm24-toxin TFA
Cat. No.:
HY-P5917A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.