1. Others
  2. Fluorescent Dye
  3. RAD21 (356–395), biotin labeled

RAD21 (356–395), biotin labeled is biotin-labeled RAD21 (356–395) (HY-P10931). RAD21 (356–395) is a peptide encompassing amino acids 356 to 395 of the RAD21 protein, which can be used to study the interaction mechanism between STAG1 and RAD21. The equilibrium dissociation constant (KD) value for the interaction between RAD21 (356–395) and STAG1 is 127 nM.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

RAD21 (356–395), biotin labeled

RAD21 (356–395), biotin labeled Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of RAD21 (356–395), biotin labeled:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

RAD21 (356–395), biotin labeled is biotin-labeled RAD21 (356–395) (HY-P10931). RAD21 (356–395) is a peptide encompassing amino acids 356 to 395 of the RAD21 protein, which can be used to study the interaction mechanism between STAG1 and RAD21. The equilibrium dissociation constant (KD) value for the interaction between RAD21 (356–395) and STAG1 is 127 nM[1].

Molecular Weight

5216.30

Formula

C241H390N60O60S4

Sequence

{Biotin-Ttds}-Pro-Thr-Lys-Lys-Leu-Met-Met-Trp-Lys-Glu-Thr-Gly-Gly-Val-Glu-Lys-Leu-Phe-Ser-Leu-Pro-Ala-Gln-Pro-Leu-Trp-Asn-Asn-Arg-Leu-Leu-Lys-Leu-Phe-Thr-Arg-Cys-Leu-Thr-Pro

Sequence Shortening

{Biotin-Ttds}-PTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTP

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RAD21 (356–395), biotin labeled
Cat. No.:
HY-P10931F
Quantity:
MCE Japan Authorized Agent: