2. GPCR/G Protein
  3. GHSR
  4. GHRF, mouse TFA

GHRF, mouse TFA  (Synonyms: Mouse growth hormone-releasing factor TFA)

Cat. No.: HY-P3596A
Handling Instructions Technical Support

GHRF, mouse TFA, a mouse growth hormone-releasing factor, is a peptide containing 44 amino acids. GHRF, mouse TFA stimulates the release and synthesis of growth hormone.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GHRF, mouse TFA

GHRF, mouse TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of GHRF, mouse TFA:

GHRF, mouse TFA Related Antibodies

Top Publications Citing Use of Products

View All GHSR Isoform Specific Products:

View All Isoforms
GHSR1a

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GHRF, mouse TFA, a mouse growth hormone-releasing factor, is a peptide containing 44 amino acids. GHRF, mouse TFA stimulates the release and synthesis of growth hormone[1].

Molecular Weight

5032.74 (free base)

Formula

C220H365N69O64S.xC2HF3O2
Sequence

His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser
Sequence Shortening

HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

GHRF, mouse TFA Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

GHRF, mouseMouse growth hormone-releasing factorGHSRGrowth hormone secretagogue receptorGhrelin receptorIGF-Iliver-specific deletion of IGF-IpeptideInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GHRF, mouse TFA
Cat. No.:
HY-P3596A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.