1. GPCR/G Protein
  2. GCGR
  3. GLP-2(1-33)(human)

GLP-2(1-33)(human)  (Synonyms: GLP-2 (human); Glucagon-like peptide 2 (human))

Cat. No.: HY-P1024 Purity: 98.24%
Handling Instructions Technical Support

GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-2(1-33)(human)

GLP-2(1-33)(human) Chemical Structure

CAS No. : 223460-79-5

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

IC50 & Target

GLP-2 receptor[1]

In Vitro

GLP-2-treated group demonstrates a 518% increase in mucosal IGFBP-4 mRNA levels as compare with vehicle-treated controls. Because the mucosal expression of IGFBP-4 transcripts is found to be very low relative to that of the whole intestine, FRIC cultures are used as an in vitro model of the entire intestine. FRIC cultures have previously been established to express a functional GLP-2 receptor (GLP-2R) that displays a cAMP response, as well as enhances IGF-1 mRNA expression and IGF-1 secretion in response to GLP-2 treatment. When incubates with GLP-2 (10 8 M) for 2 hours, IGFBP-4 mRNA expression in the FRIC cultures is also found to be increased, by 40.8%, compare with vehicle-treated cells[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

GLP-2 quickly increases apoB48 mass in the TRL fraction of plasma, which is indicative of chylomicron number, and this is blocked by L-NAME. GLP-2 treatment alone increases postprandial TRL-lipids (slope 3.65×10 3 g/L/min vs 1.63×10 3 g/L/min, GLP-2 vs control), and this effect is completely mitigated by L-NAME pretreatment (slope 3.67×10 4 g/L/min). The GLP-2-induced rise in TRL-apoB48 occurres within 30 minutes and precedes the rise in TRL-TG. GLP-2 acutely increases plasma tritium levels (slope, 1.66±0.25×102 dpm/mL/min vs 1.11±0.17×102 dpm/mL/min, GLP-2 vs control)[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3766.19

Formula

C165H254N44O55S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp

Sequence Shortening

HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : ≥ 100 mg/mL (26.55 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : 25 mg/mL (6.64 mM; ultrasonic and adjust pH to 9 with NH4OH)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2655 mL 1.3276 mL 2.6552 mL
5 mM 0.0531 mL 0.2655 mL 0.5310 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
Cell Assay
[1]

Fetal rat intestinal cells (FRICs) are collected by enzymatical digestion of whole fetal rat intestines (mixed sex) and cultured overnight in DMEM containing 4.5 g/L glucose, 5% fetal bovine serum, and 40 U/mL penicillin and 40 μg/mL streptomycin in 10 cm plates. Cells are then treated with GLP-2 (10−8 M) or vehicle in low-glucose DMEM with 0.5% FBS for 0.5 to 24 hours[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Administration
[2]

Hamsters that undergo intraduodenal catheterization (idc) are allowed 7 days of recovery before jugular vein catheterization. For postprandial experiments, conscious fasted (16 h) hamsters receive a 75 mmol/kg iv bolus of L-NAME. After 10 minutes, baseline blood sample is collected (time 0), followed by an oralgastric gavage of 3 μL Ci [9,10-3H(N)] triolein in 200 μL olive oil. At t=10 minutes, F-127 is given ip (1 g/kg) to inhibit peripheral TG-rich lipoprotein (TRL) catabolism. At t=20 minutes, the hamsters receive ip injections of either PBS or 0.25 mg/kg human GLP-2(1-33). Blood (400 μL) is collected every 30 minutes for 2 hours. Blood is centrifuged at 6000 rpm for 10 minutes at 4°C to isolate plasma. Radioactivity is assessed using a liquid scintillation counter[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O / DMSO 1 mM 0.2655 mL 1.3276 mL 2.6552 mL 6.6380 mL
5 mM 0.0531 mL 0.2655 mL 0.5310 mL 1.3276 mL
DMSO 10 mM 0.0266 mL 0.1328 mL 0.2655 mL 0.6638 mL
15 mM 0.0177 mL 0.0885 mL 0.1770 mL 0.4425 mL
20 mM 0.0133 mL 0.0664 mL 0.1328 mL 0.3319 mL
25 mM 0.0106 mL 0.0531 mL 0.1062 mL 0.2655 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-2(1-33)(human)
Cat. No.:
HY-P1024
Quantity:
MCE Japan Authorized Agent: