1. MAPK/ERK Pathway Stem Cell/Wnt
  2. ERK
  3. Endothelin-1 (1-31) (Human) TFA

Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Endothelin-1 (1-31) (Human) TFA

Endothelin-1 (1-31) (Human) TFA Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Endothelin-1 (1-31) (Human) TFA:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Endothelin-1 (1-31) (Human) TFA

View All ERK Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase[1].

In Vitro

Endothelin-1 (1-31) (Human) (100 pM-100 nM; 24 h) TFA induces human mesangial cells proliferation[2].
Endothelin-1 (1-31) (Human) (100 nM; 0-10 min) TFA induces ERK activation in human mesangial cells[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Proliferation Assay[2]

Cell Line: Human mesangial cells
Concentration: 100 pM-100 nM
Incubation Time: 24 h
Result: Caused an increase in [3H]-thymidine incorporation into the cells in a concentration-dependent manner.

Western Blot Analysis[2]

Cell Line: Human mesangial cells
Concentration: 100 nM
Incubation Time: 0, 5, 10, 15 and 30 min
Result: ERK activities rapidly increased 2.45-fold at 5 min and peaked at 10 min. The activities of both ERKs rapidly declined, returning to the baseline control value 30 min after stimulation.
In Vivo

ET-1 (1-31) (100 nM; single dose) TFA induces contraction in the mouse mesenteric artery. The contraction may be mediated by the ETA receptor and may be increased by aging. A clear difference exists between males and females in the present chronic diabetic condition[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: ICR mice, Streptozocin (HY-13753)-induced diabetic model[1]
Dosage: 100 nM
Administration: In the organ bath, single dose
Result: In the 1-week control (but not diabetic) group, induced contraction and the contractile response was significantly greater in female mice than in male mice, and there was no significant difference in either male or female mice between the age-matched controls and the diabetic mice. In the 8-weeks group, the contraction was or tended to be increased compared with the corresponding 1-week group in all mice. Although in male mice this contraction was not different between control and diabetic groups, it was significantly greater in diabetic female mice than in the control female mice and in female diabetic mice than in male diabetic mice. The contraction was inhibited by ETA receptor inhibitor.
Molecular Weight

3742.18

Formula

C164H237F3N38O49S5

Appearance

Solid

Color

White to off-white

Sequence

Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)

Sequence Shortening

CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

H2O : 50 mg/mL (13.36 mM; adjust pH to 10 with NH4OH)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2672 mL 1.3361 mL 2.6722 mL
5 mM 0.0534 mL 0.2672 mL 0.5344 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.79%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2672 mL 1.3361 mL 2.6722 mL 6.6806 mL
5 mM 0.0534 mL 0.2672 mL 0.5344 mL 1.3361 mL
10 mM 0.0267 mL 0.1336 mL 0.2672 mL 0.6681 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Endothelin-1 (1-31) (Human) TFA
Cat. No.:
HY-P4159A
Quantity:
MCE Japan Authorized Agent: