Endothelin-1 (1-31) (Human) TFA

Name: Endothelin-1 (1-31) (Human) TFA
Brand: MedChemExpress
SKU: HY-P4159A
Rating: 4.5 (1 reviews)

Cat. No.: HY-P4159A Purity: 99.79%: Data Sheet
SDS

COA
Handling Instructions
FAQs
Technical Support

Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Endothelin-1 (1-31) (Human) TFA Chemical Structure

Size	Stock	Quantity
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	In-stock	Estimated Time of Arrival: December 31
50 mg	Get quote
100 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Endothelin-1 (1-31) (Human) TFA:

Endothelin-1 (1-31) (Human) Get quote
Endothelin-1 (1-31) (Human) acetate Get quote

1 Publications Citing Use of MCE Endothelin-1 (1-31) (Human) TFA

•Acta Pharmacol Sin. 2024 Mar;45(3):545-557. [Abstract]

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

View All ERK Isoform Specific Products:

View All Isoforms

ERK ERK1 ERK2 ERK5 ERK8

Biological Activity
Purity & Documentation
References
Customer Review

Description

Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase^[1].

In Vitro

Endothelin-1 (1-31) (Human) (100 pM-100 nM; 24 h) TFA induces human mesangial cells proliferation^[2].
Endothelin-1 (1-31) (Human) (100 nM; 0-10 min) TFA induces ERK activation in human mesangial cells^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Proliferation Assay^[2]

Cell Line:	Human mesangial cells
Concentration:	100 pM-100 nM
Incubation Time:	24 h
Result:	Caused an increase in [³H]-thymidine incorporation into the cells in a concentration-dependent manner.

Western Blot Analysis^[2]

Cell Line:	Human mesangial cells
Concentration:	100 nM
Incubation Time:	0, 5, 10, 15 and 30 min
Result:	ERK activities rapidly increased 2.45-fold at 5 min and peaked at 10 min. The activities of both ERKs rapidly declined, returning to the baseline control value 30 min after stimulation.

In Vivo

ET-1 (1-31) (100 nM; single dose) TFA induces contraction in the mouse mesenteric artery. The contraction may be mediated by the ET_A receptor and may be increased by aging. A clear difference exists between males and females in the present chronic diabetic condition^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	ICR mice, Streptozocin (HY-13753)-induced diabetic model^[1]
Dosage:	100 nM
Administration:	In the organ bath, single dose
Result:	In the 1-week control (but not diabetic) group, induced contraction and the contractile response was significantly greater in female mice than in male mice, and there was no significant difference in either male or female mice between the age-matched controls and the diabetic mice. In the 8-weeks group, the contraction was or tended to be increased compared with the corresponding 1-week group in all mice. Although in male mice this contraction was not different between control and diabetic groups, it was significantly greater in diabetic female mice than in the control female mice and in female diabetic mice than in male diabetic mice. The contraction was inhibited by ET_A receptor inhibitor.

Molecular Weight

3742.18

Formula

C₁₆₄H₂₃₇F₃N₃₈O₄₉S₅

Appearance

Solid

Color

White to off-white

Sequence

Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)

Sequence Shortening

CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility

In Vitro:

H₂O : 50 mg/mL (13.36 mM; adjust pH to 10 with NH4OH)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2672 mL	1.3361 mL	2.6722 mL
5 mM	0.0534 mL	0.2672 mL	0.5344 mL
10 mM	0.0267 mL	0.1336 mL	0.2672 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 99.79%

Select Batch:

Data Sheet (279 KB) SDS (252 KB)

COA (248 KB) LCMS (95 KB)

Handling Instructions (2659 KB)

References

[1]. Matsumoto T, et al. Gender differences in vascular reactivity to endothelin-1 (1-31) in mesenteric arteries from diabetic mice. Peptides. 2008 Aug;29(8):1338-46. [Content Brief]

[2]. Yoshizumi M, et al. Effect of endothelin-1 (1-31) on human mesangial cell proliferation. Jpn J Pharmacol. 2000 Oct;84(2):146-55. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.2672 mL	1.3361 mL	2.6722 mL	6.6806 mL
	5 mM	0.0534 mL	0.2672 mL	0.5344 mL	1.3361 mL
	10 mM	0.0267 mL	0.1336 mL	0.2672 mL	0.6681 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.