1. GPCR/G Protein Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. CART(55-102)(rat) TFA

CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CART(55-102)(rat) TFA

CART(55-102)(rat) TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of CART(55-102)(rat) TFA:

Other Forms of CART(55-102)(rat) TFA:

Top Publications Citing Use of Products

View All Neuropeptide Y Receptor Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior[1][2].

Molecular Weight

5373.20

Formula

C228H368F3N65O67S7

Sequence

Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47)

Sequence Shortening

IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CART(55-102)(rat) TFA
Cat. No.:
HY-P1305A
Quantity:
MCE Japan Authorized Agent: