1. Protein Tyrosine Kinase/RTK
  2. Insulin Receptor
  3. human GIP(3-30), amide

Human GIP(3-30), amide is a high affinity antagonist of the human GIP receptor in vitro. Human GIP(3-30), amide has potential anti-obesity and anti-diabetic effects.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

human GIP(3-30), amide Chemical Structure

human GIP(3-30), amide Chemical Structure

CAS No. : 1884226-05-4

Size Price Stock Quantity
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of human GIP(3-30), amide:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Human GIP(3-30), amide is a high affinity antagonist of the human GIP receptor in vitro. Human GIP(3-30), amide has potential anti-obesity and anti-diabetic effects[1][2].

In Vitro

Human GIP(3-30), amide (0.01-10 µM, 20 min) competitively binds to GIP receptor (GIPR), blocking GIP-mediated cAMP accumulation (Ki=16.8 nM), β-arrestin recruitment (Ki for β-arrestin-1/2 recruitment is 10.6 nM and 10.2 nM) and receptor internalization[2].
Human GIP(3-30), amide (0.01-10 µM, 30 min) inhibits GIP mediated insulin secretion and signal transduction in adipocytes[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3297.69

Formula

C150H226N38O44S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2

Sequence Shortening

EGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : ≥ 100 mg/mL (30.32 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3032 mL 1.5162 mL 3.0324 mL
5 mM 0.0606 mL 0.3032 mL 0.6065 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.3032 mL 1.5162 mL 3.0324 mL 7.5811 mL
5 mM 0.0606 mL 0.3032 mL 0.6065 mL 1.5162 mL
10 mM 0.0303 mL 0.1516 mL 0.3032 mL 0.7581 mL
15 mM 0.0202 mL 0.1011 mL 0.2022 mL 0.5054 mL
20 mM 0.0152 mL 0.0758 mL 0.1516 mL 0.3791 mL
25 mM 0.0121 mL 0.0606 mL 0.1213 mL 0.3032 mL
30 mM 0.0101 mL 0.0505 mL 0.1011 mL 0.2527 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
human GIP(3-30), amide
Cat. No.:
HY-P10138
Quantity:
MCE Japan Authorized Agent: