1. GPCR/G Protein
  2. GLP Receptor
  3. Exendin(9-39) amide acetate

Exendin(9-39) amide acetate  (Synonyms: Avexitide acetate)

Cat. No.: HY-P0264A
Handling Instructions Technical Support

Exendin(9-39) amide (Avexitide) acetate is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for the GLP-1R, counteracting the effects of excessive GLP-1 secretion. Exendin(9-39) amide acetate can be utilized in Postbariatric hypoglycemia (PBH) research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Exendin(9-39) amide acetate Chemical Structure

Exendin(9-39) amide acetate Chemical Structure

CAS No. : 2051593-46-3

Size Price Stock Quantity
1 mg Get quote 3 - 4 weeks 2 - 3 weeks 2 - 3 weeks
5 mg Get quote 3 - 4 weeks 2 - 3 weeks 2 - 3 weeks
10 mg Get quote 3 - 4 weeks 2 - 3 weeks 2 - 3 weeks
25 mg Get quote 3 - 4 weeks 2 - 3 weeks 2 - 3 weeks
50 mg   Get quote  
100 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 29 publication(s) in Google Scholar

Other Forms of Exendin(9-39) amide acetate:

Top Publications Citing Use of Products

29 Publications Citing Use of MCE Exendin(9-39) amide acetate

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Exendin(9-39) amide (Avexitide) acetate is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for the GLP-1R, counteracting the effects of excessive GLP-1 secretion. Exendin(9-39) amide acetate can be utilized in Postbariatric hypoglycemia (PBH) research[1].

Clinical Trial
Molecular Weight

3549.91

Formula

C155H246N40O53S

CAS No.
Sequence

Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Sequence Shortening

DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Exendin(9-39) amide acetate Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Exendin(9-39) amide acetate
Cat. No.:
HY-P0264A
Quantity:
MCE Japan Authorized Agent: