Search Result
Results for "
ameliorated
" in MedChemExpress (MCE) Product Catalog:
8
Biochemical Assay Reagents
20
Isotope-Labeled Compounds
| Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-124179
-
|
|
NF-κB
|
Cancer
|
|
IT-901 is an orally active and potent NF-κB subunit c-Rel inhibitor with an IC50 of 0.1 μM, 3 μM for NF-κB DNA binding and c-Rel DNA binding, respectively. IT-901, a bioactive naphthalenethiobarbiturate derivative, has the potential for human lymphoid tumors and ameliorate graft-versus-host disease (GVHD) .
|
-
-
- HY-17616
-
|
LEO 43204
|
Drug Metabolite
|
Others
|
|
Ingenol disoxate (LEO 43204) is a drug metabolite, that exhibits potential in ameliorating actinic keratosis .
|
-
-
- HY-125120
-
|
|
Bacterial
|
Others
|
|
Kansuiphorin C ameliorates malignant ascites by modulating gut microbiota and related metabolic functions .
|
-
-
- HY-N1485
-
|
Astramembrangenin; Cyclosieversigenin
|
Telomerase
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
|
Cycloastragenol (Astramembrangenin), the active form of astragaloside IV, has anti-oxidant, anti-inflammatory, anti-aging, anti-apoptotic, and cardiovascular protective effects. Cycloastragenol is a potent telomerase activator and can lengthen telomeres. Cycloastragenol alleviates age-related bone loss and improves bone microstructure and biomechanical properties .
|
-
-
- HY-N1458
-
-
-
- HY-175149
-
|
|
Tyrosine Hydroxylase
|
Metabolic Disease
|
|
2-Fluorodeoxyarbutin, a derivative of Deoxyarbutin (HY-B1461), is a tyrosine hydroxylase and dopa oxidase inhibitor. 2-Fluorodeoxyarbutin inhibits melanin synthesis in intact melanocytes. 2-Fluorodeoxyarbutin can be used for the strudy of skin lightening or for ameliorating hyperpigmented lesions .
|
-
-
- HY-N15152
-
|
|
Others
|
Metabolic Disease
|
|
Isoaesculioside D (compound 3) is an agent for preventing or ameliorating skin aging. Isoaesculioside D exhibits an excellent effect on the suppression of formation, or the amelioration, of wrinkles on the skin or sagging skin .
|
-
-
- HY-120943
-
|
BM 17.0744
|
PPAR
|
Metabolic Disease
|
|
K-111 (BM-170744) is an oral active PPAR alpha agonist. K-111 show efficacy in improving insulin resistance, reducing body weight, and ameliorating atherogenic dyslipidemia. K-111 can be used for study of type 2 diabetes, dyslipidaemia, obesity and the metabolic syndrome .
|
-
-
- HY-N1458R
-
|
|
Reference Standards
Parasite
Autophagy
p62
Reactive Oxygen Species (ROS)
|
Infection
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
Isoschaftoside (Standard) is the analytical standard of Isoschaftoside. This product is intended for research and analytical applications. Isoschaftoside, a C-glycosylflavonoid from Desmodium uncinatum root exudate, can inhibit growth of germinated S. hermonthica radicles. Isoschaftoside reduces reactive oxygen species (ROS) and induces proliferation in senescent cells. Isoschaftoside activates autophagy. Isoschaftoside can be used for anti-tumor, anti-inflammatory, antioxidant, antihypertensive, hepatoprotective and nematicidal study.
|
-
-
- HY-N1485R
-
|
Astramembrangenin (Standard); Cyclosieversigenin (Standard)
|
Reference Standards
Telomerase
|
Neurological Disease
Inflammation/Immunology
|
|
Cycloastragenol (Standard) is the analytical standard of Cycloastragenol. This product is intended for research and analytical applications. Cycloastragenol (Astramembrangenin), the active form of astragaloside IV, has anti-oxidant, anti-inflammatory, anti-aging, anti-apoptotic, and cardiovascular protective effects. Cycloastragenol is a potent telomerase activator and can lengthen telomeres. Cycloastragenol alleviates age-related bone loss and improves bone microstructure and biomechanical properties .
|
-
-
- HY-109718
-
-
-
- HY-N3182
-
|
|
Others
|
Neurological Disease
|
|
N-Methylnuciferine, an alkaloid from Lotus Plumule, ameliorate lipopolysaccharide-induced depression-like behavior .
|
-
-
- HY-N3182A
-
-
-
- HY-111536
-
-
-
- HY-162378
-
-
-
- HY-N9349
-
-
-
- HY-164021
-
|
BR-222; UR389
|
Drug Derivative
|
Others
|
|
Brovanexine hydrochloride (BR-222; UR389) is an expectorant, which reduces the adsorption capacity of sputum and ameliorates lung ventilation function .
|
-
-
- HY-W581819
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Ferric glycinate is an iron amino acid chelate used as a food fortifier and therapeutic agent, which can prevent and ameliorate iron deficiency anemia .
|
-
-
- HY-111327
-
|
|
Glycosidase
|
Metabolic Disease
|
|
Valibose is analpha-glucosidaseinhibitor, and ameliorates the metabolic disorder of glucose and lipids and the nephropathy in Streptozotocin (HY-13753)-induced diabetic rats .
|
-
-
- HY-N0785
-
-
-
- HY-152264
-
|
|
CFTR
|
Inflammation/Immunology
|
|
CFTR activator 1 is a potent and selective CFTR activator, with an EC50 of 23 nM. CFTR activator 1 can be used to ameliorate dry eye disease .
|
-
-
- HY-N7981
-
|
|
NF-κB
|
Neurological Disease
|
|
Pratensein, a flavonoid, ameliorates β-amyloid-induced cognitive impairment in rats via reducing oxidative damage and restoring synapse and BDNF levels .
|
-
-
- HY-161248
-
|
|
Microtubule/Tubulin
|
Cancer
|
|
E7130 is a microtubule inhibitor, which ameliorates the tumor microenvironment through suppression of cancer-associated fibroblasts (CAF) and promotion of tumor vasculature remodeling .
|
-
-
- HY-14741
-
|
S-30563; TAK-851
|
HPV
|
Infection
|
|
Epetirimod (S-30563; TAK-851) is an immune-response modifier, that ameliorates the cervical human papilloma virus (HPV) infection and cervical dysplasia .
|
-
-
- HY-105435
-
-
-
- HY-N4244
-
-
-
- HY-N3710
-
|
Kumujian G; O-Methylpicrasidine I
|
JAK
Apoptosis
|
Neurological Disease
Cancer
|
Dehydrocrenatidine, a natural alkaloid, is a specific JAK inhibitor. Dehydrocrenatidine inhibits voltage-gated sodium channels and ameliorates mechanic allodia in a rat model of neuropathic pain .
|
-
-
- HY-122359
-
|
L-Centchroman; L-Ormeloxifene
|
Estrogen Receptor/ERR
|
Endocrinology
Cancer
|
|
Levormeloxifene (L-Centchroman) is a selective estrogen receptor modulator (SERM), which prevents and ameliorates postmenopausal osteoporosis. Levormeloxifene causes multiple adverse gynecological effects .
|
-
-
- HY-118824A
-
|
(E/Z)-Moschamine
|
Others
|
Cardiovascular Disease
|
|
N-Feruloylserotonin, an antioxidative component and bioactive serotonin derivative, from the Seed of Carthamus tinctorius L., ameliorates atherosclerosis and distensibility of the aortic wall in Kurosawa and Kusanagi-hypercholesterolemic (KHC) rabbits .
|
-
-
- HY-N8903
-
-
-
- HY-18344
-
|
SR 121463
|
Vasopressin Receptor
|
Metabolic Disease
|
|
Satavaptan (SR 121463) is an antagonist for vasopressin V2 receptor. Satavaptan regulates the vasopressin regulated phosphopeptides and vasopressin-mediated signaling pathway. Satavaptan is potential in ameliorating hyponatremia .
|
-
-
- HY-129246
-
|
|
DNA/RNA Synthesis
|
Cancer
|
|
Cytembena is inhibitor for replicative DNA synthesis, purine synthesis and tetrahydrofolate formylase activity. Cytembena ameliorates ovarian or breast cancer, relieves the pain from skeletal metastases .
|
-
-
- HY-155657
-
|
|
Src
|
Inflammation/Immunology
|
|
BT424 is a specific HCK inhibitor. BT424 can regulate macrophage activation and autophagy in vitro. BT424 ameliorates inflammation and kidney fibrosis in UUO model .
|
-
-
- HY-153650
-
-
-
- HY-100701
-
-
-
- HY-101590A
-
|
L 16726 dihydrochloride
|
Parasite
|
Infection
|
|
Symetine dihydrochloride (L 16726 dihydrochloride) is the dihydrochloride form of Symetine (HY-101590). Symetine dihydrochloride exhibits antiprotozoal activity aginst Entamoeba histolytica, and ameliorates the amebic liver abscess in guinea pig model .
|
-
-
- HY-N3674
-
|
|
TGF-beta/Smad
|
Inflammation/Immunology
|
|
Dalbergioidin, a well-known anthocyanin, ameliorates doxorubicin-induced renal fibrosis by suppressing the TGF-β signal pathway. Dalbergioidin exhibits tyrosinase inhibitory activity with an IC50 of 20 mM .
|
-
-
- HY-144236
-
|
|
Epigenetic Reader Domain
|
Others
|
|
Considerable studies confirmed that BRD4 inhibition ameliorated kidney injury and fibrosis ,and ZLD2218 exhibited the most potent inhibitory activity against BRD4, with the IC50 value of 107 nM
|
-
-
- HY-W001583
-
|
EUK-8
|
Reactive Oxygen Species (ROS)
|
Cardiovascular Disease
|
|
Manganese(salen) chloride (EUK-8), a superoxide dismutase and catalase mimetic, is an antioxidant with oxyradical scavenging properties. Manganese(salen) chloride ameliorates acute lung injury in endotoxemic swine .
|
-
-
- HY-163652
-
|
|
Others
|
Metabolic Disease
|
|
Glicetanile is an orally active hypoglycemic agent, that stimulates the release of insulin from pancreatic beta cells, and lowers the blood sugar. Glicetanile exhibits potential in ameliorating the type 2 diabetes .
|
-
-
- HY-N3006R
-
|
|
Fungal
|
Infection
Inflammation/Immunology
|
|
Sakuranetin is a cherry flavonoid phytoalexin, shows strong antifungal activity . Sakuranetin has anti-inflammatory and antioxidative activities. Sakuranetin ameliorates LPS-induced acute lung injury .
|
-
-
- HY-N3006
-
|
|
Fungal
|
Infection
Inflammation/Immunology
|
|
Sakuranetin is a cherry flavonoid phytoalexin, shows strong antifungal activity . Sakuranetin has anti-inflammatory and antioxidative activities. Sakuranetin ameliorates LPS-induced acute lung injury .
|
-
-
- HY-116597
-
|
F3MethylAA
|
PPAR
|
Inflammation/Immunology
|
|
L-783483 (F3MethylAA) is an agonist for PPARδ. L-783483 ameliorates Carrageenan (HY-125474)-induced paw edema in mice .
|
-
-
- HY-P99578
-
|
HL036337; HBM9036
|
TNF Receptor
|
Inflammation/Immunology
|
|
Tanfanercept (HL036337) is an TNF-α receptor fusion protein that targets TNF-α. Tanfanercept is effective in ameliorating corneal erosions in a dry eye (DE) mouse model .
|
-
-
- HY-121169
-
|
Ro 14-4767; Ro 14-4767/000
|
Fungal
|
Infection
|
|
Amorolfine (Ro 14-4767) is an antifungal agent. Amorolfine ameliorates the onychomycosis through inhibition of ergosterol biosynthesis. Amorolfine inhibits Candida albicans with a MIC of 0.404 µg/mL .
|
-
-
- HY-18347
-
|
YM 087 free base
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Conivaptan (YM 087 free base) is antagonist for vasopressin V1A receptor and vasopressin V2 receptor. Conivaptan ameliorates congestive heart failure, improves cardiac systolic function .
|
-
-
- HY-151217
-
|
RO-71554
|
Parasite
|
Infection
|
|
Ipronidazole (RO-71554) is an orally active antihistomonal agent, which prevents and ameliorates enterohepatitis in turkeys. Ipronidazole can promotes turkey growth when supplied in feed or drinking water .
|
-
-
- HY-B1063
-
|
Terpin monohydrate; cis-Terpin hydrate
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
|
Terpin hydrate (cis-Terpin hydrate) is an expectorant, commonly used in the research of mucus associated with acute and chronic bronchitis. Terpin hydrate ameliorates Paraquat dichloride (HY-B0864A)-induced lung damage .
|
-
-
- HY-121401A
-
|
(1R)-(−)-Myrtenal; (−)-(1R,5S)-Myrtenal
|
Akt
|
Metabolic Disease
Cancer
|
|
(-)-Myrtenal ((1R)-(-)-Myrtenal) is an orally active terpene with antitumour activity. (-)-Myrtenal ameliorates hyperglycemia by enhancing GLUT2 through Akt in the skeletal muscle and liver of diabetic rats .
|
-
-
- HY-161718
-
|
|
Adenosine Receptor
|
Inflammation/Immunology
|
|
MRS8028 is an agonist for A3 adenosine receptor (A3AR), which binds hA3AR with Ki of 2.44 nM. MRS8028 is potential for ameliorating ischemia and inflammatory diseases .
|
-
- HY-120897
-
|
|
Bcl-2 Family
Apoptosis
|
Inflammation/Immunology
|
|
NS-3-008 hydrochloride is an orally active transcriptional inhibitor of G0/G1 switch 2 (G0s2) with an IC50 of 2.25 μM. NS-3-008 hydrochloride can be used for chronic kidney disease .
|
-
- HY-141411A
-
|
(S)-MRI-1867
|
Cannabinoid Receptor
NO Synthase
|
Metabolic Disease
|
|
Zevaquenabant ((S)-MRI-1867) is a peripherally restricted, orally bioavailable dual cannabinoid CB1 receptor and inducible NOS antagonist. Zevaquenabant ameliorates obesity-induced chronic kidney disease (CKD) .
|
-
- HY-N10496
-
|
|
Others
|
Inflammation/Immunology
|
|
Sericoside is a triterpenoid with anti-inflammatory activity, can be isolated form Terminalia. Sericoside has a strong lipolytic activity. Sericoside can also reduce skin wrinkles and ameliorating skin texture .
|
-
- HY-105450
-
|
|
iGluR
|
Neurological Disease
|
|
GPI-3000 is a NMDA receptor antagonist. GPI-3000 can ameliorate metabolic injury and shows neuroprotective effect. GPI-3000 can be used for the researches of metabolic and neurological disease .
|
-
- HY-128064
-
-
- HY-126871
-
|
|
Farnesyl Transferase
|
Metabolic Disease
Cancer
|
|
Zaragozic acid D2 is the inhibitor for squalene synthase and Ras farnesyl-protein transferase (Ras FPTase), with IC50 of 2 nM and 100 nM, respectively. Zaragozic acid D2 is potentially ameliorating hypercholesterolemia and Ras-induced cancer .
|
-
- HY-W402682
-
|
|
Amino acid Transporter
|
Neurological Disease
Cancer
|
|
SXC2023 is an inhibitor for solute carrier family 7 member 11 (SLC7A11). SXC2023 exhibits antitumor efficacy, and ameliorates central nervous system disorder through downregulation of glutamate export .
|
-
- HY-112185
-
|
LY3502970; GLP-1 receptor agonist 1
|
GCGR
|
Metabolic Disease
|
|
Orforglipron (LY3502970) (Compound 67) is an orally active agonist for Glucagon-like peptide-1 receptor (GLP-1R), which exhibits potency in ameliorates the type 2 diabete .
|
-
- HY-120450
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
CL-55 is an inhibitor for type three secretion system of Chlamydia trachomatis, that blocks the effector molecules delivery of bacteria into host cells. CL-55 ameliorates the C. trachomatis infection and inflammation in mice .
|
-
- HY-122604
-
|
|
DNA/RNA Synthesis
|
Neurological Disease
|
|
PF-DcpSi is a mRNA decapping scavenger enzyme (DcpS) inhibitor (IC50: 0.11 nM). PF-DcpSi (30 mg/kg,i.p.) ameliorates the disease phenotype in a mice model of spinal muscular atrophy (SMA) .
|
-
- HY-114586
-
|
|
Angiotensin Receptor
|
Cancer
|
|
L-158809 is an angiotensin type 1 (AT1) receptor antagonist that prevents or ameliorates fractionated whole-brain irradiation-induced cognitive impairment. L-158809 is promising for research of brain tumor .
|
-
- HY-N13031
-
|
|
Bacterial
|
Infection
|
|
Bellericagenin A is a pentacyclic triterpenic acid isolated from the bark of Terminalia bellerica. Bellericagenin A exhibits antimicrobial activity. Bellericagenin A exhibits a high affinity to alcohol dehydrogenase (ADH), which has the potential for ameliorating the alcoholic liver injury .
|
-
- HY-120796
-
|
MW01-11-108SRM hydrochloride
|
p38 MAPK
|
Neurological Disease
|
|
MW108 (MW01-11-108SRM) hydrochloride is a selective and CNS-penetrant p38αMAPK inhibitor with a Ki of 114 nM. MW108 hydrochloride ameliorates beta-amyloid induced synaptic and cognitive dysfunction .
|
-
- HY-102092
-
|
PD 147953
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
FR139317 (PD 147953) is a selective ETA receptor antagonist. FR139317 inhibits cerebral activation by intraventricular endothelin-1 in conscious rats. FR139317 also ameliorates cerebral vasospasm in dogs .
|
-
- HY-105296
-
|
|
Sigma Receptor
mAChR
|
Cancer
|
|
Blarcamesine is an orally bioavailable Sigma-1 receptor agonist and muscarinic receptor modulator, with anticonvulsant, anti-amnesic, neuroprotective and antidepressant properties. Blarcamesine ameliorates neurologic impairments in a mouse model of Rett syndrome .
|
-
- HY-135014
-
|
|
Melanocortin Receptor
Adrenergic Receptor
|
Others
|
|
Undecylenoyl phenylalanine is an antagonist for α-melanocyte-stimulating hormone (MSH) and β-adrenergic receptor (β-ADR) to reduce the melanogenesis in melanocytes, reduces hyperpigmentation and thus ameliorates melasma lesions and solar lentigines .
|
-
- HY-103017
-
|
|
IRAK
|
Infection
|
|
JH-X-119-01 hydrochloride is a potent and selective interleukin-1 receptor-associated kinases 1 (IRAK1) inhibitor. JH-X-119-01 hydrochloride ameliorates LPS-induced sepsis in mice .
|
-
- HY-121191
-
|
N1,N8-Bisnorcymserine; (-)-Bisnorcymserine
|
Cholinesterase (ChE)
|
Neurological Disease
|
|
Bisnorcymserine ((-)-Bisnorcymserine) is an inhibitor for butyrylcholinesterase (BChE) with an IC50 of 0.228 nM. Bisnorcymserine reduces the levels of amyloid-β peptide (Aβ), exhibits ameliorates the Alzheimer’s Disease in elderly rat models. Bisnorcymserine is blood-brain barrier penetrate .
|
-
- HY-170747
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
9-tert-Butyldoxycycline exhibits immunomodulatory activity, alters the polarization states polymorphonuclear neutrophils, and ameliorates the inflammatory response in ischemia-reperfusion injury model. 9-tert-Butyldoxycycline is the ligand for ‘Tet-On’ switch system .
|
-
- HY-W023253
-
|
|
Bacterial
Fungal
|
Infection
Inflammation/Immunology
|
|
Biclotymol is an antimicrobial agent against gram-positive cocci. Biclotymol inhibits Streptococcus pneumoniae and Haemophilus influenzae, with MIC of 150 and 150 μM. Biclotymol exhibits anti-inflammatory and analgesic activity and ameliorates the otolaryngology infection and throat sore .
|
-
- HY-157430
-
|
|
Epigenetic Reader Domain
|
Neurological Disease
|
|
BET-IN-21 (compound 16) is a blood-brain barrier-permeable extra terminal domain (BET) inhibitor with the Ki of 230 nM. BET-IN-21 inhibits microglia activation and has ameliorative effects on experimental autoimmune encephalomyelitis mice .
|
-
- HY-129228
-
|
|
Parasite
|
Infection
|
|
Lychnopholide is a sesquiterpene lactone derived from the Asteraceae, Lychnopholide exhibits anti-trypanosomal activity against Trypanosoma cruzi. lychnopholide encapsulated in nanocapsules reduces its toxicity to mammalian cells. Lychnopholide ameliorates Chagas disease in mouse models .
|
-
- HY-117597
-
|
|
PPAR
|
Metabolic Disease
|
|
YM440 is an orally active oxadiazolidinedione analog. YM440 ameliorates hyperglycemia without changing PPARy activity, adipocyte differentiation, or fat weight. YM440 is used in the study for non-insulin-dependent diabetes mellitus (NIDDM) .
|
-
- HY-W010144R
-
|
|
COX
Lipoxygenase
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Phenidone, an orally active dual inhibitor of cyclooxygenase (COX) and lipoxygenase (LOX), ameliorates rat paralysis in experimental autoimmune encephalomyelitis. Phenidone is a potent hypotensive agent in the spontaneously hypertensive rat . Phenidone is used as a photographic developer .
|
-
- HY-B0589H
-
|
|
HMG-CoA Reductase (HMGCR)
Autophagy
|
Cardiovascular Disease
|
|
Strontium atorvastatin is a cholesterol-lowering drug with activity in ameliorating cardiovascular disease-related events. Strontium atorvastatin exerts its biological activity by inhibiting HMG-CoA reductase in liver tissue. Strontium atorvastatin is also used to suppress dyslipidemia .
|
-
- HY-107527
-
|
|
GlyT
|
Neurological Disease
|
|
Org 25543 hydrochloride is a selective and irreversible GlyT2 inhibitor (IC50: 16 nM). Org 25543 hydrochloride has analgesia effect. Org 25543 hydrochloride ameliorates mechanical allodynia after partial sciatic nerve ligation injury in mice .
|
-
- HY-W010144
-
|
|
COX
Lipoxygenase
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Phenidone, an orally active dual inhibitor of cyclooxygenase (COX) and lipoxygenase (LOX), ameliorates rat paralysis in experimental autoimmune encephalomyelitis. Phenidone is a potent hypotensive agent in the spontaneously hypertensive rat . Phenidone is used as a photographic developer .
|
-
- HY-113919
-
|
|
Calcium Channel
|
Inflammation/Immunology
|
|
Nothofagin, a dihydrochalcone, is isolated from rooibos (Aspalathus linearis) . Nothofagin downregulates NF-κB translocation through blocking calcium influx. Nothofagin has antioxidant activity and ameliorates various inflammatory responses such as the septic response and vascular inflammation .
|
-
- HY-N0785R
-
-
- HY-118157
-
|
|
MMP
|
Inflammation/Immunology
|
|
3,5,7-Trimethoxyflavone, a flavonoid compound, can inhibit the TNF-α-induced high expression and secretion of MMP-1 by cells. 3,5,7-Trimethoxyflavone can be used to ameliorate skin damage .
|
-
- HY-B0463
-
|
Clomifene citrate
|
Estrogen Receptor/ERR
|
Neurological Disease
Endocrinology
Cancer
|
|
Clomiphene citrate (Clomifene citrate) is an orally active estrogen-receptor modulator. Clomiphene citrate has anti-cancer actixity, induces perturbations during meiotic maturation and cytogenetic abnormalities and ameliorates in managing psychiatric and cognitive impairment .
|
-
- HY-146292
-
|
|
Epigenetic Reader Domain
|
Infection
|
|
BET-IN-8 (Compound 27) is a potent inhibitor of BET with a Ki and Kd of 0.83 and 0.571 μM, respectively. BET-IN-8 ameliorates LPS-induced sepsis in vivo. BET-IN-8 has the potential for the research of sepsis .
|
-
- HY-P10269
-
|
GZR18
|
GLP Receptor
|
Metabolic Disease
|
|
Bofanglutide (GZR18) is an analog of glucagon-like peptide-1 (GLP-1), which exhibits agonistic activity for GLP-1 receptor, with an EC50 of 0.677 nM. GZR18 ameliorates type 2 diabetes .
|
-
- HY-110262
-
|
|
MAP3K
p38 MAPK
|
Inflammation/Immunology
|
|
MSC 2032964A is an orally active, selective inhibitor for apoptosis signal-regulating kinase 1(ASK1) with IC50 of 96 nM. MSC 2032964A preserves the visual responses in EAE mice model and exhibits potency in ameliorating the neuroinflammation .
|
-
- HY-17481A
-
|
|
Others
|
Inflammation/Immunology
|
|
Bumadizone calcium is the calcium salt of Bumadizone (HY-17481). Bumadizone calcium is a non-steroidal anti-inflammatory drug, that exhibits potential in ameliorating chronic inflammatory diseases. Bumadizone calcium is irritant to the gastric lining, which leads to gastric bleeding and ulceration .
|
-
- HY-106262B
-
|
KAI-9803 hydrochloride; BMS-875944 hydrochloride
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
-
- HY-161864
-
|
|
STAT
|
Inflammation/Immunology
|
|
STAT3-IN-29 (Compound B20) is an inhibitor for STAT3. STAT3-IN-29 inhibits the proliferation of HaCaT cell with IC50 of 0.09 µM, ameliorates the IMQ-induced psoriasis in mouse models .
|
-
- HY-N0901A
-
|
|
α-synuclein
|
Neurological Disease
Cancer
|
Corynoxine B is an alkaloid-based autophagy inducer and α-synuclein aggregation inhibitor that ameliorates Mn-induced dysregulation of autophagy and enhances α-synuclein (α-syn) clearance in Parkinson's disease mice .
|
-
- HY-P10272
-
|
PTG-300
|
Ferroportin
|
Others
|
|
Rusfertide is a peptide mimetic of natural hepcidin, which targets and degrades ferroportin, reduces serum iron and transferrin-saturation, and thus regulates the production of red blood cells. Rusfertide ameliorates the polycythemia vera, β-thalassemia and hereditary hemochromatosis .
|
-
- HY-120380
-
|
|
Autophagy
|
Inflammation/Immunology
|
|
FeTMPyP is an orally active peroxynitrite (ONOO ) scavenger. FeTMPyP reduces nitrative stress and increases autophagy. FeTMPyP reduces PARP over-activation and neuroinflammation in chronic constriction injury (CCI)-induced rats, and ameliorates functional, behavioral and biochemical deficits .
|
-
- HY-106262
-
|
KAI-9803; BMS-875944
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Delcasertib (KAI-9803) is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
-
- HY-173624
-
-
- HY-W166297
-
|
|
p38 MAPK
|
Cancer
|
|
Esculin sesquihydrate, a fluorescent coumarin glucoside, is an active ingredient of ash bark. Esculin sesquihydrate ameliorates cognitive impairment in experimental diabetic nephropathy (DN), and exerts anti?oxidative stress and anti?inflammatory effects, via the MAPK signaling pathway .
|
-
- HY-111021
-
|
|
LPL Receptor
|
Inflammation/Immunology
|
|
ASP-4058 is a next-generation, selective and oral bioactive agonist for Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5), ameliorates rodent experimental autoimmune encephalomyelitis with a favorable safety profile .
|
-
- HY-101826A
-
|
|
Phosphodiesterase (PDE)
|
Cancer
|
|
ER21355 hydrochloride is the hydrochloride form of ER21355 (HY-101826). ER21355 hydrochloride is an inhibitor for phosphodiesterase (PDE), which is potent for ameliorating benign prostatic hyperplasia (BPH) and prostatism through increasing levels of cAMP and cGMP, and resulting a relaxation of the smooth muscle cell .
|
-
- HY-126762
-
|
|
Progesterone Receptor
|
Endocrinology
|
|
Fenprostalene is an analog of Dinoprost (PGF2α) (HY-12956) that is used in veterinary medicine to induce corpus luteum regression and blood Progesterone (HY-N0437) levels reduction in dogs. Fenprostalene is potent in ameliorating pyometra and inducing abortion .
|
-
- HY-111021A
-
|
|
LPL Receptor
|
Inflammation/Immunology
|
|
ASP-4058 hydrochloride is a next-generation, selective and orally active agonist for Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5), ameliorates rodent experimental autoimmune encephalomyelitis with a favorable safety profile .
|
-
- HY-B0580B
-
|
(+)-Ketorolac
|
Ras
|
Cancer
|
|
(R)-Ketorolac is an orally active Cdc42 and Rac1 inhibitor. (R)-Ketorolac inhibits GTPase. (R)-Ketorolac alters ovarian cancer cell behaviors critical for invasion and metastasis. (R)-Ketorolac ameliorates cancer-associated cachexia .
|
-
- HY-114941
-
|
BP1137
|
Angiotensin-converting Enzyme (ACE)
Neprilysin
|
Cardiovascular Disease
|
|
Aladotril (BP1137) is the inhibitor for neutral endopeptidase (NEP) and angiotensin-converting enzyme (ACE), that ameliorates the cardiac hypertrophy in rats, without decreasing the blood pressure. Aladotril can be used in research about heart failure and cardiac remodeling after myocardial infarction .
|
-
- HY-19420
-
|
|
Phosphodiesterase (PDE)
|
Others
|
|
UK 357903 is a selective inhibitor for phosphodiesterase 5 (PDE5), with IC50s of 1.7 and 714 nM, for PDE5 and PDE6. UK 357903 exhibits vasodilatory effects on the mesenteric and hindlimb vascular beds, and is potential for ameliorating erectile dysfunction .
|
-
- HY-131651
-
|
LTB4 ethanolamide
|
Endogenous Metabolite
Leukotriene Receptor
|
Cancer
|
|
Leukotriene B4 ethanolamide (LTB4 ethanolamide) is an antagonist and a partial agonist for Leukotriene B4 (LTB4) receptor 1 (BLTR1). Leukotriene B4 ethanolamide ameliorates the tumor progression, which is only asscociated with inflammation .
|
-
- HY-120225
-
|
|
p38 MAPK
|
Inflammation/Immunology
|
|
NJK14047 inhibits p38 MAPK and the differentation of naive T-cells to Th1 and Th17 cells. NJK14047 ameliorates the collage-induced rheumatoid arthritis and Imiquimod (HY-B0180)-induced psoriasis in mice .
|
-
- HY-N0045
-
-
- HY-125516
-
|
|
Endogenous Metabolite
|
Others
Inflammation/Immunology
|
|
MCTR3 is a potent cytokine of pro-resolving mediating maresin conjugates in tissue regeneration (MCTR), which reduces the inflammatory response and promotes the tissue regeneration. MCTR3 exhibits potency in ameliorating LPS-induced acute lung injury and arthritis .
|
-
- HY-N12141
-
|
|
Apoptosis
|
Inflammation/Immunology
|
|
Flaccidoside II inhibits proliferation and induces apoptosis in Malignant peripheral nerve sheath tumors (MPNSTs) cell lines. Flaccidoside II ameliorates collagen-induced arthritis in mice. Flaccidoside II is an active triterpenoid saponin constituent from Anemone flaccida rhizome .
|
-
- HY-B0702
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Nicergoline, an ergoline derivative ester of bromonicotinic acid, is a potent, selective and orally active antagonist of α1A-adrenoceptor. Nicergoline has vasodilator effects. Nicergoline also has ameliorative effects on cognitive function in mouse models of Alzheimer's disease .
|
-
- HY-13818
-
Stattic
Maximum Cited Publications
251 Publications Verification
|
STAT
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
Stattic is a potent STAT3 inhibitor and inhibits STAT3 phosphorylation (at Y705 and S727) . Stattic inhibits the binding of a high affinity phosphopeptide for the SH2 domain of STAT3 . Stattic ameliorates the renal dysfunction in Alport syndrome (AS) mice .
|
-
- HY-151217R
-
|
RO-71554 (Standard)
|
Reference Standards
Parasite
|
Infection
|
|
Ipronidazole (Standard) is the analytical standard of Ipronidazole. This product is intended for research and analytical applications. Ipronidazole (RO-71554) is an orally active antihistomonal agent, which prevents and ameliorates enterohepatitis in turkeys. Ipronidazole can promotes turkey growth when supplied in feed or drinking water .
|
-
- HY-B1063R
-
|
Terpin monohydrate (Standard); cis-Terpin hydrate (Standard)
|
Biochemical Assay Reagents
Reference Standards
|
Inflammation/Immunology
|
|
Terpin (hydrate) (Standard) is the analytical standard of Terpin (hydrate). This product is intended for research and analytical applications. Terpin hydrate (cis-Terpin hydrate) is an expectorant, commonly used to remove mucus in patients with acute and chronic bronchitis. Terpin hydrate ameliorates Paraquat dichloride (HY-B0864A)-induced lung damage.
|
-
- HY-168264
-
|
|
NOD-like Receptor (NLR)
|
Neurological Disease
|
|
MC1 is a potent NLRP3 inhibitor with a KD value of 19.3 nM. MC1 shows no cytotoxicity. MC1 ameliorates cognitive deficits without eliciting adverse effects and shows an absence of hepatotoxicity. MC1 has the potential for the research of Alzheimer's disease (AD) .
|
-
- HY-17505
-
|
TCV-116
|
Angiotensin Receptor
Apoptosis
|
Cardiovascular Disease
Endocrinology
|
|
Candesartan Cilexetil (TCV-116) is an angiotensin II receptor inhibitor. Candesartan Cilexetil ameliorates the pulmonary fibrosis and has antiviral and skin wound healing effect. Candesartan Cilexetil can be used for the research of high blood pressure .
|
-
- HY-151342
-
|
|
Drug Derivative
|
Others
|
|
Ser@TPP@CUR is a Curcumin (HY-N0005) derivative. Ser@TPP@CUR effectively ameliorates injured renal tubular epithelial cells and improves renal functions of acute kidney injury (AKI) mice. Ser@TPP@CUR can be used for the research of AKI .
|
-
- HY-164605
-
|
|
Aldehyde Dehydrogenase (ALDH)
|
Metabolic Disease
|
|
(6S)-CP-470711 (Compound 8) is an inhibitor for sorbitol dehydrogenase, that inhibits human and rat SDH with IC50 of 19 nM and 27 nM. (6S)-CP-470711 ameliorates the Streptozotocin (HY-13753)-induced diabetes in rats models .
|
-
- HY-N1388
-
|
|
Others
|
Inflammation/Immunology
|
|
Tussilagone, a major active component in Tussilago farfara, has anti-inflammatory effect. Tussilagone ameliorates inflammatory responses in dextran sulphate sodium-induced murine colitis. Tussilagone inhibits the inflammatory response and improves survival in cecal ligation and puncture (CLP)-induced septic mice .
|
-
- HY-101938
-
-
- HY-N2707
-
|
|
Reactive Oxygen Species (ROS)
|
Neurological Disease
Cancer
|
|
6-Deoxyjacareubin is a natural xanthone, that can be isolated from the leaves of Vismia latifolia. 6-Deoxyjacareubin protects against non-apoptotic cell death by inhibiting ROS production. 6-Deoxyjacareubin ameliorates neurodegeneration in a mouse model of familial amyotrophic lateral sclerosis (ALS) .
|
-
- HY-18039
-
|
SEN15924
|
Cholinesterase (ChE)
|
Neurological Disease
|
|
WAY-361789 (SEN15924) is an orally active agonist for α7 nicotinic acetylcholine receptor (α7 nAChR) with an EC50 of 0.18 μM. WAY-361789 improves the cognitive function, exhibits potential in ameliorating Alzheimer’s Disease and schizophrenia .
|
-
- HY-168331
-
|
|
FXR
|
Others
|
|
FXR agonist 10 (Compound 27) is an agonist for FXR with an EC50 of 14.26 μM. FXR agonist 10 upregulates the expression of SHP and BSEP proteins, downregulates the expression of NTCP and CYP7A1 proteins. FXR agonist 10 ameliorates the ANIT-induced cholestasis in mouse model .
|
-
- HY-149708
-
|
|
ICMT
|
Others
|
|
UCM-13207 (compound 21) is a selective ICMT inhibitor that ameliorates basic progeria-like features. UCM-13207 can improve the survival rate of LmnaG609G/G609G mice in the mouse premature aging model .
|
-
- HY-24504
-
-
- HY-141411B
-
|
(R)-MRI-1867
|
Drug Isomer
Cannabinoid Receptor
NO Synthase
|
Others
|
|
(R)-Zevaquenabant ((R)-MRI-1867) is the enantiomer of Zevaquenabant (HY-141411A). Zevaquenabant ((S)-MRI-1867) is a peripherally restricted, orally bioavailable dual cannabinoid CB1 receptor and inducible NOS antagonist. Zevaquenabant ameliorates obesity-induced chronic kidney disease (CKD) .
|
-
- HY-12586
-
|
|
Thrombin
|
Others
|
|
AZD6564 is an orally active inhibitor for fibrinolysis through disruption of plasma kinase-fibrin interaction. AZD6564 dissolves human plasma clot with an IC50 of 0.44 μM. AZD6564 ameliorates hemorrhage in rats with EC50 of 1.62 μM, and exhibits good pharmacokinetic characteristics in rats .
|
-
- HY-120381
-
|
CAM 1189
|
Cholecystokinin Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
PD 136450 (CAM 1189) is an antagonist for cholecystokinin 2 (CCK2). PD 136450 exhibits anti-secretory, anxiolytic and anti-ulcer activities, inhibits gastric acid secretion (IC50=1 mg/kg), and ameliorates the haemorrhagic lesions (IC50=4.7 mg/kg) in rats .
|
-
- HY-P11046
-
|
|
Interleukin Related
|
Inflammation/Immunology
|
|
IIIM1 is an orally active anti-inflammatory peptide. IIIM1 ameliorates the symptoms of experimental autoimmune encephalomyelitis (EAE) by stimulating the proliferation of regulatory T cells and inducing them to produce RA1, and regulating the cytokine balance. IIIM1 can be used in the research of multiple sclerosis (MS) .
|
-
- HY-N3542
-
|
|
Glycosidase
|
Cancer
|
|
Carpachromene is a potent α-glucosidase enzyme inhibitor. Carpachromene ameliorates insulin resistance in HepG2 cells via modulating IR/IRS1/PI3k/Akt/GSK3/FoxO1 pathway .
|
-
- HY-161343
-
|
|
P2Y Receptor
Necroptosis
|
Inflammation/Immunology
|
|
HDL-16 is a potent P2Y14R antagonist with an IC50 of 0.3095 nM. HDL-16 ameliorates DSS (HY-116282C)-induced colitis through suppressing necroptosis of intestinal epithelium cells (IECs) and protecting mucosal barrier function .
|
-
- HY-114766
-
|
|
Phosphodiesterase (PDE)
|
Inflammation/Immunology
|
|
Pumafentrine is an orally active, potent dual PDE3/PDE4 inhibitor. Pumafentrine dose-dependently ameliorates the clinical score and colonic TNFα production in murine Dextran sulphate sodium (DSS; HY-116282C)-induced colitis in a preventive setting .
|
-
- HY-161465
-
|
|
HDAC
|
Inflammation/Immunology
|
HDAC8-IN-7 (H7E), a HDAC8 inhibitor, exerts retinoprotective effects against glaucomatous injury via ameliorating aberrant Müller glia activation and oxidative stress. HDAC8-IN-7 alleviates functional and structural defects within the inner retina .
|
-
- HY-13458A
-
|
L-DOPS hydrochloride; DOPS hydrochloride; SM5688 hydrochloride
|
Adrenergic Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Droxidopa (L-DOPS) hydrochloride is a potent, orally active norepinephrine precursor. Droxidopa hydrochloride increases standing blood pressure, ameliorates symptoms of orthostatic hypotension and improves standing ability. Droxidopa hydrochloride has the potential for the research of neurogenic orthostatic hypotension (nOH) and alternative ADHD (attention deficit hyperactivity disorder) .
|
-
- HY-N6884
-
-
- HY-168327
-
|
|
FXR
|
Inflammation/Immunology
|
|
LH10 is a fexaramine-based agonist for FXR with an EC50 of 0.14 μM. LH10 exhibits liver protection efficacy, ameliorates the alpha naphthylisothiocyanate (ANIT)-induced cholestasis, APAP (HY-66005)-induced acute liver injury and non-alcoholic steatohepatitis (NASH) in mouse models .
|
-
- HY-158311
-
|
|
RANKL/RANK
p38 MAPK
NF-κB
|
Endocrinology
|
|
Anti-osteoporosis agent-8 (Compound 4aa) is an inhibitor for RANKL, which inhibits RANKL-induced osteoclastogenesis and osteoclast differentiation (IC50 is 2.41 μM) in cells RAW264.7. Anti-osteoporosis agent-8 ameliorates bone loss in an ovariectomized (OVX) mice model .
|
-
- HY-108659
-
|
|
P2Y Receptor
|
Inflammation/Immunology
|
|
NF340 is a potent and selective P2Y11 receptor antagonist. NF340 inhibits the activity of P2Y11R by completely combining with ATP-binding amino acid residues. NF340 ameliorates inflammation in human fibroblast-like synoviocytes and can be used for rheumatoid arthritis research .
|
-
- HY-130307
-
|
|
Bacterial
|
Neurological Disease
Inflammation/Immunology
Cancer
|
|
Rubrofusarin is an orange polyketide pigment from Fusarium graminearum . Rubrofusarin is also an active ingredient of the Cassia species and ameliorates chronic restraint stress (CRS) -induced depressive symptoms through PI3K/Akt signaling. Rubrofusarin has anticancer, antibacterial, and antioxidant effects .
|
-
- HY-W668775
-
-
- HY-N1419R
-
|
|
Reference Standards
AMPK
|
Metabolic Disease
|
|
Vaccarin (Standard) is the analytical standard of Vaccarin. This product is intended for research and analytical applications. Vaccarin is an active flavonoid glycoside associated with various biological functions. Vaccarin significantly promote wound healing and endothelial cells and fibroblasts proliferation in the wound site. Vaccarin ameliorates insulin resistance and steatosis by activating the AMPK signaling pathway .
|
-
- HY-13458
-
|
L-DOPS; DOPS; SM5688
|
Adrenergic Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Droxidopa (L-DOPS; SM5688) is a potent, orally active norepinephrine precursor. Droxidopa increases standing blood pressure, ameliorates symptoms of orthostatic hypotension and improves standing ability. Droxidopa has the potential for the research of neurogenic orthostatic hypotension (nOH) and alternative ADHD (attention deficit hyperactivity disorder) .
|
-
- HY-120229
-
|
|
Protein Prenyltransferase
|
Neurological Disease
|
|
GGTI-2147 is a potent GGTase I inhibitor. GGTI-2147 blocks geranyl-geranylation of Rap1A and reduces the activity of Rac1 (one of substrates for GGTI) and ameliorates the OGD/R-induced neuronal apoptosis.GGTI-2147 can be used for neurodevelopmental disorders research, such as autism, depression, and schizophrenia .
|
-
- HY-B0149R
-
|
cyclocapron (Standard)
|
Reference Standards
IGF-1R
AMPK
MMP
Mitophagy
|
Cardiovascular Disease
Neurological Disease
Cancer
|
|
Tranexamic acid (Standard) is the analytical standard of Tranexamic acid. This product is intended for research and analytical applications. Tranexamic acid (cyclocapron), a cyclic analog of lysine, is an orally active antifibrinolytic agent. Tranexamic acid attenuates the effects of severe trauma, inhibits urokinase plasminogen activator and ameliorates dry wrinkles. Tranexamic acid can used for the research of hemostasis .
|
-
- HY-N0278
-
|
Pulsatilla camphor; Anemonine; trans-Anemonin
|
PKC
NO Synthase
|
Inflammation/Immunology
|
|
Anemonin (Pulsatilla camphor), a selective iNOS inhibitor, is also a PKC-θ inhibitor. Anemonin can significantly inhibit the translation or protein stability of PKC-θ protein. Anemonin also ameliorates dextran sodium sulfate-induced acute ulcerative colitis (UC) in mice. Anemonin can be used in the research of inflammation-related diseases .
|
-
- HY-162632
-
|
|
Akt
CXCR
|
Inflammation/Immunology
|
|
Hit 14 is an inhibitor for C-X-C chemokine receptor type 4 (CXCR4) with IC50 of 254 nM. Hit 14 inhibits the migration and invasion of cell MDA-MB-231. Hit 14 inhibits the Akt phosphorylation, exhibits anti-inflammatory activity, and ameliorateds the ear swelling and damage in mouse models .
|
-
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-158403
-
|
|
METTL3
|
Inflammation/Immunology
|
|
METTL3-IN-7 (7460-0250) is a potent METTL3 inhibitor. METTL3-IN-7 strongly ameliorates Dextran sulfate sodium salt (DSS) (HY-116282C)-induced colitis. METTL3-IN-7 can be used Inflammatory bowel disease (IBD) research .
|
-
- HY-136181A
-
YNT-185
1 Publications Verification
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
YNT-185 is a nonpeptide, selective orexin type-2 receptor (OX2R) agonist, with EC50s of 0.028 and 2.75 μM for OX2R and OX1R, respectively. YNT-185 ameliorates narcolepsy-cataplexy symptoms in mouse models .
|
-
- HY-112185A
-
|
LY3502970 hemicalcium hydrate; GLP-1 receptor agonist 1 hemicalcium hydrate
|
GCGR
|
Metabolic Disease
|
|
Orforglipron hemicalcium hydrate (LY3502970 hemicalcium hydrate; GLP-1 receptor agonist 1 hemicalcium hydrate) is the calcium salt hydrate form of Orforglipron (HY-112185). Orforglipron is an orally active agonist for Glucagon-like peptide-1 receptor (GLP-1R), which exhibits potency in ameliorating the type 2 diabete .
|
-
- HY-141535
-
|
|
Interleukin Related
|
Infection
Inflammation/Immunology
|
|
IL-17 modulator 1 is an orally active, highly efficacious small molecule IL-17 modulators extracted from patent WO 2020127685. IL-17 modulator 1 can be used for the research of preventing, researching or ameliorating a variety of diseases including psoriasis, ankylosing spondylitis and psoriatic arthritis .
|
-
- HY-136181
-
|
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
YNT-185 dihydrochloride is a nonpeptide, selective orexin type-2 receptor (OX2R) agonist, with EC50s of 0.028 and 2.75 μM for OX2R and OX1R, respectively. YNT-185 dihydrochloride ameliorates narcolepsy-cataplexy symptoms in mouse models .
|
-
- HY-169853
-
|
|
VISTA
|
Inflammation/Immunology
|
|
M351-0056 is the agonist for the immune checkpoint protein VISTA, that reduces the secretion of VISTA-induced cytokines, promotes the T-cell proliferation induced by VISTA, and exhibits immunomodulatory activity. M351-0056 ameliorates Imiquimod (HY-B0180)-induced psoriatic dermatitis in mouse models .
|
-
- HY-121006
-
|
|
Mitochondrial Metabolism
AMPK
Insulin Receptor
|
Metabolic Disease
Cancer
|
|
Biguanide is an orally active antihyperglycemic agent. Biguanide inhibits mitochondrial ATP production, activates the LKB1-AMPK signaling pathway, and damages the energy homeostasis. Biguanide enhances insulin-receptor activation and downstream signaling. Biguanide exhibits potential in ameliorating the type 2 diabetes and the insulin-associated cancers.
|
-
- HY-B0412
-
Estriol
5 Publications Verification
Oestriol
|
Estrogen Receptor/ERR
Endogenous Metabolite
|
Cancer
|
|
Estriol (Oestriol), an orally active estrogen, is a ERα and ERβ agonist. Estriol is a potent GPR30 antagonist in estrogen receptor-negative breast cancer cells. Estriol can ameliorate disease severity through immunomodulatory mechanisms that decrease tissue inflammation. Estriol has powerful proconvulsant effects .
|
-
- HY-18204A
-
|
LCZ696
|
Angiotensin Receptor
Neprilysin
Apoptosis
|
Cardiovascular Disease
Endocrinology
Cancer
|
|
Sacubitril/Valsartan (LCZ696), comprised Valsartan and Sacubitril (AHU377) in 1:1 molar ratio, is a first-in-class, orally bioavailable, and dual-acting angiotensin receptor-neprilysin (ARN) inhibitor for hypertension and heart failure . Sacubitril/Valsartan ameliorates diabetic cardiomyopathy by inhibiting inflammation, oxidative stress and apoptosis .
|
-
- HY-108622
-
|
Daxalipram
|
Phosphodiesterase (PDE)
Interleukin Related
IFNAR
|
Inflammation/Immunology
|
|
Mesopram (Daxalipram) is an orally active phosphodiesterase (PDE) 4 inhibitor. Mesopram inhibits the synthesis of proinflammatory cytokines TNF-α and IFN-γ. Mesopram demonstrates efficacy in ameliorating Dextran sulfate sodium (DSS) (HY-116282C)-induced murine colitis. Mesopram can be used for the study of chronic inflammatory diseases .
|
-
- HY-163885
-
|
|
Cholinesterase (ChE)
Beta-secretase
γ-secretase
|
Neurological Disease
|
|
SSZ is a multi-target inhibitor, which targets multiple pathological mechanisms of Alzheimer's disease (AD). SSZ targets acetylcholinesterase, butyrylcholinesterase, β-site amyloid precursor protein cleavage enzyme 1 (BACE1), and γ-secretase. SSZ ameliorates Alzheimer’s diseases and exhibits neuroprotective effect in mice .
|
-
- HY-168629
-
|
|
FXR
|
Metabolic Disease
|
|
FXR agonist 9 (compound 26) is an oral active and selectivity FXR partial agonist with the EC50 of 0.09 µM (75.13 % maximum efficacy). FXR agonist 9 ameliorates pathological features in HFD and CCl4(HY-Y0298)-induced metabolic dysfunction-associated steatohepatitis mice .
|
-
- HY-101546A
-
|
(+)-Cavidine
|
COX
|
Inflammation/Immunology
|
|
Cavidine ((+)-Cavidine) is a selective COX-2 inhibitor which possesses anti-inflammatory activity. Cavidine can be used for the research of skin injuries, hepatitis, cholecystitis, and scabies. Cavidine ameliorates LPS (HY-D1056)-induced acute lung injury via NF-κB signaling pathway .
|
-
- HY-N0901AR
-
|
|
α-synuclein
Reference Standards
|
Neurological Disease
Cancer
|
|
Corynoxine B Standard is an analytical standard for Corynoxine B. This product is intended for research and analytical applications. Corynoxine B is an alkaloid-type autophagy inducer and α-synuclein aggregation inhibitor that ameliorates Mn-induced dysregulation of autophagy and enhances the clearance of α-synuclein (α-syn) in Parkinson's disease mice .
|
-
- HY-B0149S2
-
|
Cyclocapron-13C6
|
Isotope-Labeled Compounds
MMP
Mitophagy
IGF-1R
AMPK
|
Cardiovascular Disease
Neurological Disease
Cancer
|
|
Tranexamic acid- 13C6 (Cyclocapron- 13C6) is 13C labeled Tranexamic acid. Tranexamic acid (cyclocapron), a cyclic analog of lysine, is an orally active antifibrinolytic agent. Tranexamic acid attenuates the effects of severe trauma, inhibits urokinase plasminogen activator and ameliorates dry wrinkles. Tranexamic acid can used for the research of hemostasis .
|
-
- HY-164799
-
|
|
FXR
|
Inflammation/Immunology
|
|
FXR agonist 12 (Compound C7) is the orally active agonist for FXR. FXR agonist 12 down-regulates bile acid synthesis-related genes, and up-regulates bile acid transport-related genes in HepG2 cells. FXR agonist 12 improves ANIT-induced cholestasis, ameliorates the liver damage and fibrosis in mouse NASH models .
|
-
- HY-161307
-
|
|
HDAC
Microtubule/Tubulin
|
Neurological Disease
|
|
T-518 is an orally active, BBB-penetrant and potent DFMO-based HDAC6 inhibitor with high selectivity (IC50 = 36 nM). T-518 improves axonal transport. T-518 ameliorates object recognition deficit. T-518 can be studied in research for Alzheimer’s disease and tauopathy .
|
-
- HY-139973
-
|
|
Amyloid-β
|
Neurological Disease
|
|
OAB-14, is a Bexarotene (HY-14171) derivative, improves Alzheimer's disease-related pathologies and cognitive impairments by increasing β-amyloid clearance in APP/PS1 mice. OAB-14 effectively ameliorates the dysfunction of the endosomal-autophagic-lysosomal pathway in APP/PS1 transgenic mice .
|
-
- HY-158404
-
|
|
METTL3
|
Inflammation/Immunology
|
|
METTL3-IN-8 (F039-0002) is a potent METTL3 inhibitor. METTL3-IN-8 strongly ameliorates Dextran sulfate sodium salt (DSS) (HY-116282C)-induced colitis. METTL3-IN-8 can be used Inflammatory bowel disease (IBD) research .
|
-
- HY-162750
-
|
|
DYRK
Tau Protein
|
Neurological Disease
|
|
ZJCK-6-46 (32) is a potential and orally activeDYRK1A inhibitor (IC50 = 0.68 nM) with high BBB permeability (CNS+). ZJCK-6-46 (32) reduces tau phosphorylation. ZJCK-6-46 (32) ameliorates cognitive dysfunction by obviously reducing the expression of phosphorylated tau and neuronal loss in vivo .
|
-
- HY-113829
-
|
|
Antibiotic
Bacterial
|
Infection
Inflammation/Immunology
|
|
Valnemulin is an orally active broad-spectrum antibiotic against Gram-negative and Gram-positive bacteria, anaerobic bacteria, Mycoplasma, and Spirochetes. Valnemulin ameliorates enteric diseases, acute polyarthritis and enzootic pneumonia in pigs . Valnemulin exhibits anti-inflammatory efficacy against lipopolysaccharide (HY-D1056)-induced lung injury .
|
-
- HY-N11872
-
|
|
Others
|
Neurological Disease
|
|
Suffruticosol A is a neuroprotective agent that restores scopolamine-induced cellular neurodegenerative damage. Suffruticosol A ameliorates hippocampal cholinergic deficits and partially enhances BDNF signaling. Suffruticosol A has neuromodulatory effects in a Scopolamine (HY-N0296)-induced model, restoring memory and cognitive performance in mice. Suffruticosol A can be isolated from seeds of P. lactiflora .
|
-
- HY-N0261
-
|
|
TNF Receptor
COX
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Aurantio-obtusin is a anthraquinone compound that can be extracted from cassia seed. Aurantio-obtusin has the effects of decreasing blood pressure, decreasing blood lipids and anti-inflammatory.Aurantio-obtusin is an orally active vasodilator. Aurantio-obtusin ameliorates hepatic steatosis through AMPK/ autophagy- and AMPK/TFEB mediated inhibition of lipid accumulation .
|
-
- HY-160514
-
|
|
Phosphatase
|
Metabolic Disease
|
|
LXQ46 is an orally active inhibitor for protein tyrosine phosphatase 1B (PTP1B), with an IC50 of 0.190 μM. LXQ46 enhances insulin and leptin signaling pathways in insulin-resistant C2C12. LXQ46 ameliorates type 2 diabetes and increases insulin tolerance in mouse models .
|
-
- HY-N8441
-
|
17β-Neriifolin
|
Atg8/LC3
Na+/K+ ATPase
Apoptosis
Beclin1
|
Cardiovascular Disease
Inflammation/Immunology
Cancer
|
|
Neriifolin, a CNS-penetrating cardiac glycoside, is an inhibitor of the Na +, K +-ATPase. Neriifolin can target beclin 1, inhibits the formation of LC3-associated phagosomes and ameliorates experimental autoimmune encephalomyelitis (EAE) development. Neriifolin induces cell cycle arrest and apoptosis in human hepatocellular carcinoma HepG2 cells [2.
|
-
- HY-163690
-
|
|
Ser/Thr Protease
|
Inflammation/Immunology
|
|
HTRA1-IN-1 (Compound 17) is a selective inhibitor for serine protease high temperature requirement A serine peptidase 1 (HTRA1), with IC50 of 13 nM. HTRA1-IN-1 is potential for ameliorating HTRA1-related diseases, such as age-related macular degeneration (AMD), osteoarthritis, and rheumatoid arthritis .
|
-
- HY-B0702R
-
|
|
Reference Standards
Adrenergic Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Nicergoline (Standard) is the analytical standard of Nicergoline. This product is intended for research and analytical applications. Nicergoline, an ergoline derivative ester of bromonicotinic acid, is a potent, selective and orally active antagonist of α1A-adrenoceptor. Nicergoline has vasodilator effects. Nicergoline also has ameliorative effects on cognitive function in mouse models of Alzheimer's disease .
|
-
- HY-B0463R
-
|
Clomifene citrate (Standard)
|
Reference Standards
Estrogen Receptor/ERR
|
Neurological Disease
Endocrinology
Cancer
|
|
Clomiphene (citrate) (Standard) is the analytical standard of Clomiphene (citrate). This product is intended for research and analytical applications. Clomiphene citrate (Clomifene citrate) is an orally active estrogen-receptor modulator. Clomiphene citrate has anti-cancer actixity, induces perturbations during meiotic maturation and cytogenetic abnormalities and ameliorates in managing psychiatric and cognitive impairment .
|
-
- HY-128348
-
|
|
RIP kinase
|
Inflammation/Immunology
Cancer
|
|
PK68 is a potent orally active and specifical type II inhibitor of receptor-interacting kinase 1 (RIPK1) with an IC50 of ~90 nM, displays inhibition of RIPK1-dependent necroptosis. PK68 powerfully ameliorates TNF-induced systemic inflammatory response syndrome, and can be used for the research of inflammatory disorders and cancer metastasis .
|
-
- HY-119347
-
|
|
IFNAR
STAT
|
Inflammation/Immunology
Cancer
|
|
Cirsilineol, a natural flavone compound, selectively inhibits IFN-γ/STAT1/T-bet signaling in intestinal CD4 + T cells. Cirsilineol has potent immunosuppressive and anti-tumor properties. Cirsilineol significantly ameliorates trinitro-benzene sulfonic acid (TNBS)-induced T-cell-mediated experimental colitis in mice .
|
-
- HY-138257A
-
|
AS1069562; (R)-YM-08054 benzenesulfonate
|
5-HT Receptor
Serotonin Transporter
|
Neurological Disease
Metabolic Disease
|
(R)-Indeloxazine benzenesulfonate (AS1069562) is an orally active 5-HT and NE reuptake inhibitor, with IC50 values of 0.35 μM and 3.3 μM, respectively. (R)-Indeloxazine benzenesulfonate (AS1069562) possesses curative-like analgesic effect. (R)-Indeloxazine benzenesulfonate (AS1069562) might improve nerve function impairment via the amelioration of neurotrophic support .
|
-
- HY-13818R
-
|
|
STAT
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
Stattic (Standard) is the analytical standard of Stattic. This product is intended for research and analytical applications. Stattic is a potent STAT3 inhibitor and inhibits STAT3 phosphorylation (at Y705 and S727) . Stattic inhibits the binding of a high affinity phosphopeptide for the SH2 domain of STAT3 . Stattic ameliorates the renal dysfunction in Alport syndrome (AS) mice .
|
-
- HY-149417
-
|
|
HDAC
Cholinesterase (ChE)
|
Neurological Disease
|
|
BChE/HDAC6-IN-1 is a potent and selective dual BChE/HDAC6 inhibitor with IC50 values of 4 and 8.9 nM, respectively. BChE/HDAC6-IN-1 ameliorates the cognitive impairment in an Aβ1–42-induced mouse model and has the potental for AD research .
|
-
- HY-N1388R
-
|
|
Reference Standards
Others
|
Inflammation/Immunology
|
|
Tussilagone (Standard) is the analytical standard of Tussilagone. This product is intended for research and analytical applications. Tussilagone, a major active component in Tussilago farfara, has anti-inflammatory effect. Tussilagone ameliorates inflammatory responses in dextran sulphate sodium-induced murine colitis. Tussilagone inhibits the inflammatory response and improves survival in cecal ligation and puncture (CLP)-induced septic mice .
|
-
- HY-114366
-
|
|
CXCR
|
Others
|
|
BC-1485 is a small molecule inhibitor of Fibrosis-inducing E3 ligase 1 (FIEL1). BC-1485 protects PIAS4 from ubiquitin-mediated degradation. BC-1485 decreases α-SMA, BAL and CXCL1. BC-1485 ameliorates fibrotic lung injury in murine models .
|
-
- HY-118956
-
|
ABT-431 hydrochloride; DAS-431 hydrochloride
|
Dopamine Receptor
|
Neurological Disease
|
|
Adrogolide hydrochloride (ABT-431 hydrochloride) is a chemically stable prodrug that can convert to the dopamine D1 receptor agonist A-86929. Adrogolide hydrochloride ameliorates the MPTP (HY-15608)-induced Parkinson's Disease in marmoset model, reduces the dyskinesias tendency. Adrogolide hydrochloride reverses Risperidone (HY-11018)-induced cognitive deficits in monkey .
|
-
- HY-106961
-
|
ONO-AP 500-02
|
Prostaglandin Receptor
|
Cardiovascular Disease
|
|
ONO 1301 (ONO-AP 500-02), a prostaglandin (PG) I2 mimetic, is an orally active, long-acting prostacyclin agonist with thromboxane-synthase inhibitory activity. ONO 1301 promotes production of hepatocyte growth factor (HGF) from various cell types and ameliorates ischemia-induced left ventricle dysfunction in the mouse, rat and pig .
|
-
- HY-B0702S
-
|
|
Isotope-Labeled Compounds
Adrenergic Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Nicergoline- 13C,d3 is the 13C- and deuterium labeled Nicergoline. Nicergoline, an ergoline derivative ester of bromonicotinic acid, is a potent, selective and orally active antagonist of α1A-adrenoceptor. Nicergoline has vasodilator effects. Nicergoline also has ameliorative effects on cognitive function in mouse models of Alzheimer's disease .
|
-
- HY-W011518
-
|
|
Nucleoside Antimetabolite/Analog
Influenza Virus
|
Infection
|
|
2′-Deoxy-2′-fluoroguanosine is a nucleoside analog and potent influenza virus inhibitor with an EC90 value of <0.35 μM against influenza A and B viruses. 2′-Deoxy-2′-fluoroguanosine inhibits influenza virus replication in the upper respiratory tract, thereby ameliorating fever and nasal inflammation .
|
-
- HY-122063
-
|
|
NO Synthase
|
Inflammation/Immunology
|
|
FR260330 is a selective, orally active inhibitor for inducible nitric oxide synthase (iNOS) through suppression of iNOS dimerization. FR260330 inhibits the NO accumulation in rat splenocytes and human DLD-110 cells, with IC50 of 27 and 10 nM. FR260330 ameliorates the Lipopolysaccharides (HY-D1056)-induced inflammatory diseases in rats model .
|
-
- HY-B0004
-
-
- HY-169927
-
|
|
Ferroptosis
|
Inflammation/Immunology
|
|
Ferroptosis-IN-16 (Compound 13l) is a specific inhibitor for ferroptosis with an EC50 of 0.7 nM and 0.9 nM in ES-2 cell and LX-2 cell. Ferroptosis-IN-16 ameliorates Acetaminophen (HY-66005)-induced acute liver injury in mouse model, and exhibits good metabolic stability in mouse liver microsomes .
|
-
- HY-101318
-
|
β-FNA hydrochloride
|
Opioid Receptor
NO Synthase
|
Neurological Disease
Inflammation/Immunology
|
|
β-Funaltrexamine (β-FNA) hydrochloride is a selective μ opioid receptor antagonist. β-Funaltrexamine hydrochloride also inhibits cytokine-induced iNOS activation. β-Funaltrexamine hydrochloride inhibits neuroinflammation and ameliorated neuronal degeneration. β-Funaltrexamine hydrochloride has anti-inflammatory and neuroprotective effects and can be used for research of neurodegenerative diseases (eg: stroke) [1] [2]
|
-
- HY-W743952
-
|
|
Isotope-Labeled Compounds
Adrenergic Receptor
|
Neurological Disease
|
|
Nicergoline-d3 is the deuterium labeled Nicergoline (HY-B0702). Nicergoline, an ergoline derivative ester of bromonicotinic acid, is a potent, selective and orally active antagonist of α1A-adrenoceptor. Nicergoline has vasodilator effects. Nicergoline also has ameliorative effects on cognitive function in mouse models of Alzheimer's disease .
|
-
- HY-17638
-
|
DSP-3235 free base; KGA-3235 free base; GSK-1614235 free base
|
SGLT
|
Metabolic Disease
|
|
Mizagliflozin (DSP-3235 free base) is a potent, orally active and selective SGLT1 inhibitor, with a Ki of 27 nM for human SGLT1. Mizagliflozin displays 303-fold selectivity over SGLT2. Mizagliflozin is used as an antidiabetic agent that can modify postprandial blood glucose excursion. Mizagliflozin also exhibits potential in the amelioration of chronic constipation .
|
-
- HY-B0435
-
-
- HY-175537
-
|
|
Phosphodiesterase (PDE)
|
Inflammation/Immunology
|
|
ATX-IN-3 is an orally active autotaxin (ATX) inhibitor with an IC50 of 46 nM. ATX-IN-3 certainly reduces collagen deposition and ameliorates lung fibrosis in the pulmonary fibrosis mouse model. ATX-IN-3 has good metabolic stability and drug-like properties. ATX-IN-3 can used for the study of idiopathic pulmonary fibrosis (IFP) .
|
-
- HY-76632
-
|
|
Cholinesterase (ChE)
SOD
|
Neurological Disease
|
|
4-Hydroxyisophthalic acid activates antioxidant enzymes (such as catalase CAT and superoxide dismutase SOD), scavenges free radicals, and exhibits antioxidant property. 4-Hydroxyisophthalic acid activates AChE and BChE, enhances neuronal function and improves Tau-induced neurobehavioral defects. 4-Hydroxyisophthalic acid improves the cognitive defects, and ameliorates circadian rhythm disorders of fruit flies .
|
-
- HY-B0149
-
|
cyclocapron
|
IGF-1R
AMPK
MMP
Mitophagy
PROTAC Linkers
|
Cardiovascular Disease
Neurological Disease
Cancer
|
|
Tranexamic acid (cyclocapron), a cyclic analog of lysine, is an orally active antifibrinolytic agent. Tranexamic acid attenuates the effects of severe trauma, inhibits urokinase plasminogen activator and ameliorates dry wrinkles. Tranexamic acid can used for the research of hemostasis. Tranexamic acid is a PROTAC linker. Tranexamic acid is used to synthesize PROTACs (e.g. LZ-07 (HY-172590)) .
|
-
- HY-17505R
-
|
TCV-116 (Standard)
|
Reference Standards
Angiotensin Receptor
Apoptosis
|
Cardiovascular Disease
Endocrinology
|
|
Candesartan Cilexetil (Standard) is the analytical standard of Candesartan Cilexetil. This product is intended for research and analytical applications. Candesartan Cilexetil (TCV-116) is an angiotensin II receptor inhibitor. Candesartan Cilexetil ameliorates the pulmonary fibrosis and has antiviral and skin wound healing effect. Candesartan Cilexetil can be used for the research of high blood pressure .
|
-
- HY-N6884R
-
|
|
Reference Standards
Reactive Oxygen Species (ROS)
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Cancer
|
|
Bixin (Standard) is the analytical standard of Bixin. This product is intended for research and analytical applications.Bixin is an orally active carotenoid found in the seeds of Bixa orellana. Bixin induces apoptosis in cancer cells. Bixin possessing anti-inflammatory, anti-tumor and anti-oxidant activities. Bixin treatment ameliorated cardiac dysfunction through inhibiting fibrosis, inflammation and reactive oxygen species (ROS) generation.
|
-
- HY-B0399
-
|
(R)-Carnitine; Levocarnitine
|
Endogenous Metabolite
|
Neurological Disease
Cancer
|
|
L-Carnitine ((R)-Carnitine), a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine is an antioxidant. L-Carnitine can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-B2246
-
|
(R)-Carnitine hydrochloride; Levocarnitine hydrochloride
|
Endogenous Metabolite
|
Metabolic Disease
Cancer
|
|
L-Carnitine hydrochloride ((R)-Carnitine hydrochloride), a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine hydrochloride functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine hydrochloride is an antioxidant. L-Carnitine hydrochloride can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-124051
-
|
|
Elastase
|
Cardiovascular Disease
Inflammation/Immunology
|
|
BAY-8040 is a pyrimidopyridazine derivative which has inhibitory activity against human neutrophil elastase (HNE). BAY-8040 decreases cardiac remodeling and ameliorates cardiac function in a Monocrotaline (HY-N0750)-induced rat model for pulmonary arterial hypertension. BAY-8040 is promising for research of inflammatory pathologies and cardiopulmonary pathologies .
|
-
- HY-114286
-
|
|
Monoamine Oxidase
|
Inflammation/Immunology
|
|
PXS-5153A is a potent, selective, orally active and fast-acting lysyl oxidase like 2/3 enzymatic (LOXL2/LOXL3) inhibitor, with an IC50 of <40 nM for LOXL2 across all mammalian species and an IC50 of 63 nM for human LOXL3. PXS-5153A could reduce crosslinks and ameliorates fibrosis.
|
-
- HY-N10405
-
|
|
Keap1-Nrf2
|
Metabolic Disease
|
|
(R)-5-Hydroxy-1,7-diphenyl-3-heptanone is a diarylheptanoid that can be found in Alpinia officinarum. (R)-5-Hydroxy-1,7-diphenyl-3-heptanone ameliorates oxidative stress and insulin resistance via activation of Nrf2/ARE pathway .
|
-
- HY-W087952R
-
|
|
Drug Intermediate
Reference Standards
|
Endocrinology
|
|
Ginsenoside Rg1 (Standard) is the analytical standard of Ginsenoside Rg1. This product is intended for research and analytical applications. Ginsenoside Rg1 is one of the major active components of Panax ginseng. Ginsenoside Rg1 ameliorates the impaired cognitive function, displays promising effects by reducing cerebral Aβ levels. Ginsenoside Rg1 also reduces NF-κB nuclear translocation.
|
-
- HY-129752
-
|
|
Antibiotic
|
Cancer
|
|
Piperafizine B exhibits slightly cytotoxicity in moser cells, P388 cells and Vincristine (VCR) (HY-N0488)-resistant P388 cells (IC50s is 23.8, 22.6 and 23.7 μg/mL, respectively). Piperafizine B exhibits synergistic effects with Vincristine, enhances the VCR-induced cytotoxicity and ameliorates the leukemia in mouse model .
|
-
- HY-14829A
-
|
D-Isofagomine hydrochloride; Isofagomine hydrochloride
|
Glycosidase
|
Metabolic Disease
|
|
Afegostat hydrochloride (D-Isofagomine hydrochloride) is a potent β-galactosidase inhibitor with activity ameliorating GM1-gangliosidosis and Morquio B disease-associated mutations. Afegostat hydrochloride is able to induce the maturation of mutant β-galactosidase in fibroblasts from patients with GM1-gangliosidosis. Afegostat hydrochloride also promotes the reduction of keratin sulfate and oligosaccharide load in patient cells .
|
-
- HY-44307
-
|
|
Ferroptosis
|
Cancer
|
|
84-B10 is a 3-phenylglutaric acid derivative. 84-B10 inhibits cisplatin (HY-17394) induced tubular ferroptosis. 84-B10 attenuates cisplatin-induced mitochondrial damage and oxidative stress. 84-B10 ameliorates cisplatin-induced acute kidney injury (AKI) .
|
-
- HY-P1173
-
|
Myristoylated L 803; GSK-3β Inhibitor XIII
|
GSK-3
Amyloid-β
|
Neurological Disease
|
|
L803-mts (Myristoylated L 803) is a selective and substrate-competitive GSK-3 peptide inhibitor (IC50: 40 μM). L803-mts also reduces Aβ deposits and ameliorates cognitive deficits in 5XFAD mice. L803-mts shows antidepressive effect in the forced swimming test .
|
-
- HY-N0045R
-
|
Panaxoside A (Standard); Panaxoside Rg1 (Standard)
|
Reference Standards
Amyloid-β
NF-κB
Apoptosis
|
Neurological Disease
Inflammation/Immunology
Cancer
|
|
Ginsenoside Rg1 (Standard) is the analytical standard of Ginsenoside Rg1. This product is intended for research and analytical applications. Ginsenoside Rg1 is one of the major active components of Panax ginseng. Ginsenoside Rg1 ameliorates the impaired cognitive function, displays promising effects by reducing cerebral Aβ levels. Ginsenoside Rg1 also reduces NF-κB nuclear translocation.
|
-
- HY-N4090
-
|
|
Angiotensin-converting Enzyme (ACE)
ERK
MMP
ADAMTS
p38 MAPK
|
Cardiovascular Disease
|
|
Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC50 = 46.91 μM) that can be isolated from the aerial parts of Desmodium styracifolium. Vicenin 3 ameliorates IL-1β-induced extracellular matrix degradation in SW1353 chondrocytes by regulating the MAPK pathway. Vicenin 3 can be used for the study of osteoarthritis (OA) and hypertension .
|
-
- HY-131334
-
|
|
AMPK
|
Metabolic Disease
|
|
AMPK activator 4 is a potent AMPK activator without inhibition of mitochondrial complex I. AMPK activator 4 selectively activates AMPK in the muscle tissues. AMPK activator 4 dose-dependently improves glucose tolerance in normal mice, and significantly lowers fasting blood glucose level and ameliorates insulin resistance in db/db diabetic mice. Anti-hyperglycemic effect .
|
-
- HY-N0353R
-
|
(+)-Curdione (Standard)
|
Reference Standards
Ferroptosis
Apoptosis
Reactive Oxygen Species (ROS)
Autophagy
Glutathione Peroxidase
Keap1-Nrf2
Heme Oxygenase (HO)
TGF-β Receptor
Indoleamine 2,3-Dioxygenase (IDO)
|
Others
|
|
Curdione (Standard) is the analytical standard of Curdione. This product is intended for research and analytical applications. Curdione ((+)-Curdione) is an orally active sesquiterpenoid. Curdione inhibits platelet aggregation. Curdione induces ferroptosis in colorectal cancer via m6A methylation mediated by METTL14 and YTHDF2. Curdione inhibits ferroptosis in Isoproterenol (HY-B0468)-induced myocardial infarction by regulating the Keap1/Trx1/GPX4 signaling pathway, suppressing oxidative stress (ROS) and apoptosis. Curdione ameliorates Doxorubicin (HY-15142)-induced cardiotoxicity by inhibiting oxidative stress (ROS) and activating the Nrf2/HO-1 pathway. Curdione ameliorates sepsis-induced lung injury by inhibiting platelet-mediated neutrophil extracellular trap formation. Curdione ameliorates Bleomycin (HY-17565A)-induced pulmonary fibrosis by inhibiting TGF-β-induced fibroblast-to-myofibroblast differentiation. Curdione exhibits neuroprotective effects against focal cerebral ischemia-reperfusion injury in rats. Curdione exerts antiproliferative effects against human uterine leiomyosarcoma by targeting IDO1. Curdione protects vascular endothelial cells and atherosclerosis by regulating DNMT1-mediated ERBB4 promoter methylation. Curdione inhibits inducible prostaglandin E2 production (IC50 = 1.1 μM) and cyclooxygenase 2 expression .
|
-
- HY-N0353
-
|
(+)-Curdione
|
Ferroptosis
Apoptosis
Reactive Oxygen Species (ROS)
Autophagy
Glutathione Peroxidase
Keap1-Nrf2
Heme Oxygenase (HO)
TGF-β Receptor
Indoleamine 2,3-Dioxygenase (IDO)
|
Cardiovascular Disease
Neurological Disease
Cancer
|
|
Curdione ((+)-Curdione) is an orally active sesquiterpenoid. Curdione inhibits platelet aggregation. Curdione induces ferroptosis in colorectal cancer via m6A methylation mediated by METTL14 and YTHDF2. Curdione inhibits ferroptosis in Isoproterenol (HY-B0468)-induced myocardial infarction by regulating the Keap1/Trx1/GPX4 signaling pathway, suppressing oxidative stress (ROS) and apoptosis. Curdione ameliorates Doxorubicin (HY-15142)-induced cardiotoxicity by inhibiting oxidative stress (ROS) and activating the Nrf2/HO-1 pathway. Curdione ameliorates sepsis-induced lung injury by inhibiting platelet-mediated neutrophil extracellular trap formation. Curdione ameliorates Bleomycin (HY-17565A)-induced pulmonary fibrosis by inhibiting TGF-β-induced fibroblast-to-myofibroblast differentiation. Curdione exhibits neuroprotective effects against focal cerebral ischemia-reperfusion injury in rats. Curdione exerts antiproliferative effects against human uterine leiomyosarcoma by targeting IDO1. Curdione protects vascular endothelial cells and atherosclerosis by regulating DNMT1-mediated ERBB4 promoter methylation. Curdione inhibits inducible prostaglandin E2 production (IC50 = 1.1 μM) and cyclooxygenase 2 expression .
|
-
- HY-163651
-
|
(R)-CR6086
|
Prostaglandin Receptor
|
Inflammation/Immunology
|
|
(R)-Vorbipiprant ((R)-CR6086) is an orally active antagonist for prostaglandin E2 receptor 4 (EP4) with Ki of 16.6 nM for human EP4. (R)-Vorbipiprant inhibits PGE2 (HY-101952)-induced cAMP production with an IC50 of 22 nM. (R)-Vorbipiprant exhibits immunomodulatory and anti-angiogenic activities, and ameliorates the collagen-induced arthritis in mice .
|
-
- HY-133865
-
|
|
Interleukin Related
|
Metabolic Disease
Inflammation/Immunology
|
|
Diacetoxy-6-gingerdiol is a gingerol isolated with anti-inflammatory and antioxidant effects, which is found in the dichloromethane extract of rhizomes of ginger (Zingiber officinale Roscoe). Diacetoxy-6-gingerdiol protects the extracellular matrix of nucleus pulposus cells and ameliorates intervertebral disc degeneration by inhibiting the IL-1β-mediated NLRP3 pathway .
|
-
- HY-B0377G
-
|
MK-208 (GMP)
|
Histamine Receptor
|
Inflammation/Immunology
Cancer
|
|
Famotidine GMP (MK-208 GMP) is Famotidine (HY-B0377) produced in GMP guideline. Famotidine GMP is a competitive histamine H2-receptor antagonist, inhibits gastric secretion, activates the gastric mucosal defensive mechanisms. Famotidine GMP ameliorates peptic ulcer disease (PUD) and gastroesophageal reflux disease (GERD/GORD) in rats model .
|
-
- HY-401913
-
|
|
Phosphodiesterase (PDE)
|
Infection
Cancer
|
|
Endo CNTinh-03 is inhibitor for the elevation of cAMP and cGMP induced by agonist, such as G protein-coupled receptors, adenylate cyclase, and guanylate cyclase (IC50 is 4 μM). Endo CNTinh-03 inhibits cholera toxin- and Escherichia coli (STa) toxin- induced CFTR chloride current, ameliorates secretory diarrhea in mouse models, and prevents cyst growth in polycystic kidney disease model .
|
-
- HY-138257
-
|
(S)-AS1069562; (S)-YM-08054 benzenesulfonate
|
5-HT Receptor
|
Neurological Disease
|
|
(S)-AS1069562 is the S-enantiomer of AS1069562 (HY-138257A). AS1069562 is an orally active 5-HT and NE reuptake inhibitor, with IC50 values of 0.35 μM and 3.3 μM, respectively. AS1069562 possesses curative-like analgesic effect. AS1069562 might improve nerve function impairment via the amelioration of neurotrophic support .
|
-
- HY-18100A
-
|
|
Sigma Receptor
Akt
NO Synthase
|
Cardiovascular Disease
Neurological Disease
|
|
PRE-084 hydrochloride is a highly selective σ1 receptor (S1R) agonist, with an IC50 of 44 nM. PRE-084 hydrochloride exhibits good neuroprotective effects, can improve motor function and motor neuron survival in mice. PRE-084 hydrochloride also can ameliorate myocardial ischemia-reperfusion injury in rats by activating the Akt-eNOS pathway .
|
-
- HY-146421
-
|
|
NO Synthase
NF-κB
Reactive Oxygen Species (ROS)
|
Inflammation/Immunology
|
|
Anti-inflammatory agent 21 (compound 9o) is an orally active and low cytotoxic anti-inflammatory agent, with an IC50 value of 0.76 μM for NO. Anti-inflammatory agent 21 acts via accumulation ROS and blocks the NF-κB/MAPK signaling pathway. Anti-inflammatory agent 21 can ameliorate cartilage destruction and inflammatory cell infiltration in arthritis rats model .
|
-
- HY-101872A
-
|
|
RIP kinase
|
Inflammation/Immunology
|
|
GSK-872 hydrochloride is a RIPK3 inhibitor, which binds RIP3 kinase domain with an IC50 of 1.8 nM, and inhibits kinase activity with an IC50 of 1.3 nM. GSK-872 hydrochloride decreases the RIPK3-mediated necroptosis and subsequent cytoplasmic translocation and expression of HMGB1, as well as ameliorates brain edema and neurological deficits in early brain injury .
|
-
- HY-168713
-
|
|
FXR
|
Metabolic Disease
|
|
LZ-007 is an agonist for farnesoid X receptor (FXR) with an EC50 of 51 nM measuring by TR-FRET assay, or an EC50 of 76 nM in HepG2 cell. LZ-007 exhibits good pharmacokinetic characheristics in SD rats. LZ-007 ameliorates western diet and CCl4 (HY-Y0298)-induced mice metabolic dysfunction-associated steatohepatitis
|
-
- HY-114286A
-
|
|
Monoamine Oxidase
|
Inflammation/Immunology
|
|
PXS-5153A monohydrochloride is a potent, selective, orally active and fast-acting lysyl oxidase like 2/3 enzymatic (LOXL2/LOXL3) inhibitor, with an IC50 of <40 nM for LOXL2 across all mammalian species and an IC50 of 63 nM for human LOXL3. PXS-5153A monohydrochloride could reduce crosslinks and ameliorates fibrosis.
|
-
- HY-155782
-
|
|
RIP kinase
|
Inflammation/Immunology
|
|
Zharp2-1 is an oral effective RIPK2 inhibitor, highly associated with inflammatory bowel disease (IBD). Zharp2-1 blocker muramyl dipeptide (MDP) induces growth of mononuclear cells and induces inflammatory cell factor infection. Zharp2-1 attenuates MDP-induced small inguinal peritonitis, or ameliorates by DNBS-induced large inguinal conjunctivitis .
|
-
- HY-101872
-
|
|
RIP kinase
|
Inflammation/Immunology
|
|
GSK-872 is a RIPK3 inhibitor, which binds RIP3 kinase domain with an IC50 of 1.8 nM, and inhibits kinase activity with an IC50 of 1.3 nM. GSK-872 decreases the RIPK3-mediated necroptosis and subsequent cytoplasmic translocation and expression of HMGB1, as well as ameliorates brain edema and neurological deficits in early brain injury .
|
-
- HY-18100
-
|
|
Sigma Receptor
Akt
NO Synthase
|
Cardiovascular Disease
Neurological Disease
|
|
PRE-084 is a highly selective σ1 receptor (S1R) agonist, with an IC50 of 44 nM. PRE-084 exhibits good neuroprotective effects, can improve motor function and motor neuron survival in mice. PRE-084 also can ameliorate myocardial ischemia-reperfusion injury in rats by activating the Akt-eNOS pathway .
|
-
- HY-N9942
-
|
|
Apoptosis
Autophagy
NF-κB
p38 MAPK
PI3K
Akt
mTOR
STAT
JAK
|
Inflammation/Immunology
Cancer
|
|
Physalin A is a biologically active withanolide. Physalin A shows anti-inflammatory, antifibrotic and ameliorative effects on autophagy in models of disc degeneration. Physalin A has antitumor activity and can induce apoptosis, ROS production and G2/M phase cell cycle arrest. Besides. Physalin A can significantly increase the activity of quinone reductase and increase the expression of detoxifying enzymesc .
|
-
- HY-13458R
-
|
L-DOPS (Standard); DOPS (Standard); SM5688 (Standard)
|
Reference Standards
Adrenergic Receptor
|
Neurological Disease
|
|
Droxidopa (Standard) is the analytical standard of Droxidopa. This product is intended for research and analytical applications. Droxidopa (L-DOPS; SM5688) is a potent, orally active norepinephrine precursor. Droxidopa increases standing blood pressure, ameliorates symptoms of orthostatic hypotension and improves standing ability. Droxidopa has the potential for the research of neurogenic orthostatic hypotension (nOH) and alternative ADHD (attention deficit hyperactivity disorder) .
|
-
- HY-W105518
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
L-Carnitine tartrate is a highly polar, small zwitterion. L-Carnitine tartrate is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine tartrate functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine tartrate is an antioxidant. L-Carnitine tartrate can ameliorate metabolic imbalances in many inborn errors of metabolism [3] .
|
-
- HY-N0236
-
|
|
Antibiotic
STAT
|
Infection
Metabolic Disease
Cancer
|
|
Corylin is an orally active flavonoid anti-inflammatory and osteogenic agent that inhibits IL-6-induced STAT3 promoter activity and STAT3 phosphorylation. Corylin also has anticancer, antiatherosclerotic, and ameliorating activity in hyperlipidemia and insulin resistance, inducing adipocyte browning and lipolysis through SIRT1 or β3-AR-dependent pathways .
|
-
- HY-N0278A
-
|
(Rac)-Pulsatilla camphor; (Rac)-Anemonine
|
PKC
NO Synthase
|
Inflammation/Immunology
|
|
(Rac)-Anemonin ((Rac)-Pulsatilla camphor) is the diastereoisomer of Anemonin (HY-N0278). Anemonin (Pulsatilla camphor), a selective iNOS inhibitor, is also a PKC-θ inhibitor. Anemonin can significantly inhibit the translation or protein stability of PKC-θ protein. Anemonin also ameliorates dextran sodium sulfate-induced acute ulcerative colitis (UC) in mice. Anemonin can be used in the research of inflammation-related diseases .
|
-
- HY-W011012
-
|
|
Adenosine Receptor
|
Metabolic Disease
|
|
Adenosine 5'-monophosphate disodium is an orally active purine nucleotide, and participates in ATP metabolism. Adenosine 5'-monophosphate disodium is also a ligand for adenosine 2B receptor. Adenosine 5'-monophosphate disodium can activate AMPK in skeletal muscle, and ameliorates insulin resistance and impaired glucose metabolism. Adenosine 5'-monophosphate disodium can be used for research of diabetes .
|
-
- HY-N1876
-
|
|
Others
|
Neurological Disease
|
|
Aromadendrane-4β,10α-diol is a sesquiterpene alcohol. Aromadendrane-4β,10α-diol significantly ameliorates the Aβ1-42 peptide-induced memory impairment. Aromadendrane-4β,10α-diol can be used for Alzheimer's disease (AD) research .
|
-
- HY-P4191A
-
|
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-106994A
-
|
YM598
|
Endothelin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Cancer
|
|
Nebentan potassium (YM598) is a potent, selective and orally active non-peptide endothelin ETA receptor antagonist through the modification of Bosentan (HY-A0013). Nebentan potassium inhibits [ 125I] endothelin-1 binding to cloned human endothelin ETA and ETB receptor, with Ki of 0.697 nM and 569 nM, respectively . YM598 can ameliorate the progression of cor pulmonale and myocardial infarction in vivo .
|
-
- HY-107384
-
|
EMD-61753
|
Opioid Receptor
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
|
|
Asimadoline (EMD-61753) is an orally active, selective and peripherally active κ-opioid agonist with IC50s of 5.6 nM (guinea pig) and 1.2 nM (human recombinant). Asimadoline has low permeability across the blood brain barrier and has peripheral anti-inflammatory actions. Asimadoline ameliorates allodynia in diabetic rats and has the potential for irritable bowel syndrome (IBS) .
|
-
- HY-169290
-
|
|
JAK
HDAC
|
Inflammation/Immunology
|
|
JAK/HDAC-IN-4 (compound 11 i) is a JAK/HDAC inhibitor with the IC50 values of 0.49 nM and 12 nM for JAK2 and HDAC6, respectively. JAK/HDAC-IN-4 inhibits the cell proliferation and the production of nitric oxide. JAK/HDAC-IN-4 ameliorates psoriasis-like skin lesions in an Imiquimod (HY-B0180)-induced murine model with low toxicity .
|
-
- HY-107384A
-
|
EMD-61753 hydrochloride
|
Opioid Receptor
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
|
|
Asimadoline (EMD-61753) hydrochloride is an orally active, selective and peripherally active κ-opioid agonist with IC50s of 5.6 nM (guinea pig) and 1.2 nM (human recombinant). Asimadoline hydrochloride has low permeability across the blood brain barrier and has peripheral anti-inflammatory actions. Asimadoline hydrochloride ameliorates allodynia in diabetic rats and has the potential for irritable bowel syndrome (IBS) .
|
-
- HY-W707384
-
-
- HY-N4192
-
|
|
Others
|
Cardiovascular Disease
Cancer
|
|
Toringin, a bioflavonoid, is isolated from the bark of Docyniopsis tschonoski. Toringin progressively decreases not only the cis-effect of the expanded CTG repeats but cytotoxicity as well. Exposure to isosakuranetin, Toringin rescues PC12 neuronal cells. Flavonoids are efficacious for ameliorating the RNA gain of function caused by expanded CTG repeats, and have various biological activities and beneficial actions against cancers, coronary heart disease, among other pathologies .
|
-
- HY-103017A
-
|
|
IRAK
|
Infection
Inflammation/Immunology
Cancer
|
|
JH-X-119-01 is a potent and selective interleukin-1 receptor-associated kinases 1 (IRAK1) inhibitor. JH-X-119-01 ameliorates LPS-induced sepsis in mice . JH-X-119-01 inhibits IRAK1 biochemically with an apparent IC50 of 9 nM while exhibiting no inhibition of IRAK4 at concentrations up to 10 μM .
|
-
- HY-160186
-
|
|
Cytochrome P450
|
Cardiovascular Disease
Metabolic Disease
Endocrinology
|
|
20-SOLA is an orally active 20-HETE antagonist. 20-SOLA greatly ameliorates changes in blood pressure and renal injury associated with a Streptozotocin (STZ) (HY-13753)-diabetic mouse model. 20-SOLA facilitates the restoration of coronary collateral growth (CCG) after ischemic injury. 20-SOLA can be studied for research in cardiovascular diseases and diabetes .
|
-
- HY-100384
-
NKL 22
1 Publications Verification
|
HDAC
|
Neurological Disease
|
|
NKL 22 (compound 4b) is a potent and selective inhibitor of histone deacetylases (HDAC), with an IC50 of 199 and 69 nM for HDAC1 and HDAC3, respectively. NKL 22 exhibits selectivity over HDAC2/4/5/7/8 (IC50≥1.59 μM). NKL 22 ameliorates the disease phenotype and transcriptional abnormalities in Huntington's disease transgenic mice .
|
-
- HY-N0202
-
|
Asterolide
|
ERK
Apoptosis
p38 MAPK
Akt
Src
STAT
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
Cancer
|
|
Atractylenolide II (Asterolide) is a sesquiterpenoid compound. Atractylenolide II can induce G1 phase cell cycle arrest and apoptosis in B16 melanoma cells. Atractylenolide II is an orally effective anticancer agent that can exert anti-melanoma effects by inhibiting the STAT3 signaling pathway. In addition, Atractylenolide II has been shown to ameliorate myocardial fibrosis, oxidative stress, and neuroprotective activity .
|
-
- HY-106994
-
|
YM598 free base
|
Endothelin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Cancer
|
|
Nebentan (YM598 free base) is a potent, selective and orally active non-peptide endothelin ETA receptor antagonist through the modification of Bosentan (HY-A0013). Nebentan inhibits [ 125I] endothelin-1 binding to cloned human endothelin ETA and ETB receptor, with Ki of 0.697 nM and 569 nM, respectively . YM598 can ameliorate the progression of cor pulmonale and myocardial infarction in vivo .
|
-
- HY-P1098
-
|
|
Annexin A
NF-κB
|
Inflammation/Immunology
|
|
Ac2-26 is the N-terminal peptide of annexin 1, and has anti-inflammatory activity. Ac2-26 induces a decrease in IKKβ protein in lysosomes by chaperone-mediated autophagy (CMA). Ac2-26 ameliorates lung ischemia-reperfusion injury. Ac2-26 also inhibits airway inflammation and hyperresponsiveness in an asthma rat model .
|
-
- HY-161787
-
|
|
Histone Methyltransferase
|
Others
|
|
G9a-IN-2 (Compound 7i) is an inhibitor for histone methyltransferases G9a with IC50 of 0.024 μM. G9a-IN-2 reduces H3K9me2 levels and induces the mRNA expression of γ-globin mRNA. G9a-IN-2 shows the potential in ameliorating sickle cell disease (SCD) .
|
-
- HY-158315
-
|
|
Dipeptidyl Peptidase
|
Inflammation/Immunology
|
|
NZ-97 is an inhibitor for dipeptidyl peptidase 4 (DPP4) with an IC50 of 18 nM. NZ-97 exhibits a low initial plasma exposure with Cmax of 0.13 µM, which is eliminated in 8 h. NZ-97 ameliorates damage in the Lipopolysaccharides (HY-D1056)-induced lung injury and Bleomycin (HY-108345)-induced lung fibrosis in mice model .
|
-
- HY-P991637
-
|
|
Ser/Thr Protease
|
Metabolic Disease
|
|
REGN7999 is a monoclonal antibody that inhibits TMPRSS6. REGN7999 inhibits TMPRSS6 activity, preventing Hemojuvelin (HJV) lysis, thereby enhancing BMP6-HJV signaling and increasing serum hepcidin. REGN7999 ameliorates iron overload and impaired erythropoiesis in a β-thalassemia mouse model by inhibiting TMPRSS6 activity. REGN7999 is indicated for research in β-thalassemia .
|
-
- HY-P1098A
-
|
|
Annexin A
NF-κB
|
Inflammation/Immunology
|
|
Ac2-26 TFA is the N-terminal peptide of annexin 1, and has anti-inflammatory activity. Ac2-26 induces a decrease in IKKβ protein in lysosomes by chaperone-mediated autophagy (CMA). Ac2-26 ameliorates lung ischemia-reperfusion injury. Ac2-26 also inhibits airway inflammation and hyperresponsiveness in an asthma rat model .
|
-
- HY-N2453
-
|
|
PPAR
NF-κB
P-glycoprotein
|
Inflammation/Immunology
Cancer
|
|
Convallatoxin is a cardiac glycoside isolated from Adonis amurensis Regel et Radde. Convallatoxin ameliorates colitic inflammation via activation of PPARγ and suppression of NF-κB. Convallatoxin is a P-glycoprotein (P-gp) substrate and recognized Val982 as an important amino acid involved in its transport. Convallatoxin is an enhancer of ligand-induced MOR endocytosis with high potency and efficacy. Anti-inflammatory and anti-proliferative properties .
|
-
- HY-171590
-
|
|
Salt-inducible Kinase (SIK)
|
Inflammation/Immunology
|
|
SIK2-IN-3 is an orally active SIK1/2 selective inhibitor (IC50: 0.128/0.084 μM). SIK2-IN-3 inhibits CRTC3 phosphorylation and myeloid cell pro-inflammatory cytokine production. SIK2-IN-3 ameliorates systemic and tissue inflammatory responses in a mouse anti-CD40 colitis model .
|
-
- HY-119347R
-
|
|
Reference Standards
IFNAR
STAT
|
Inflammation/Immunology
Cancer
|
|
Cirsilineol (Standard) is the analytical standard of Cirsilineol. This product is intended for research and analytical applications. Cirsilineol, a natural flavone compound, selectively inhibits IFN-γ/STAT1/T-bet signaling in intestinal CD4+ T cells. Cirsilineol has potent immunosuppressive and anti-tumor properties. Cirsilineol significantly ameliorates trinitro-benzene sulfonic acid (TNBS)-induced T-cell-mediated experimental colitis in mice .
|
-
- HY-W764758
-
|
|
Aryl Hydrocarbon Receptor
|
Inflammation/Immunology
|
|
3-OH-Kynurenamine dihydroiodide is the dihydroiodide form of 3-OH-Kynurenamine (HY-156908). 3-OH-Kynurenamine dihydroiodide is an activator for aryl hydrocarbon receptor (AhR), and thus regulates the immune response. 3-OH-Kynurenamine dihydroiodide upregulates the expressions of Ido1 and Tgfb1, ameliorates the skin inflammation in psoriasis mouse model and kidney damage in nephrotoxic lupus mouse model .
|
-
- HY-13458S2
-
|
L-DOPS-13C6; DOPS-13C6; SM5688-13C6
|
Isotope-Labeled Compounds
Adrenergic Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Droxidopa- 13C6 (L-DOPS- 13C6) is 13C labeled Droxidopa. Droxidopa (L-DOPS; SM5688) is a potent, orally active norepinephrine precursor. Droxidopa increases standing blood pressure, ameliorates symptoms of orthostatic hypotension and improves standing ability. Droxidopa has the potential for the research of neurogenic orthostatic hypotension (nOH) and alternative ADHD (attention deficit hyperactivity disorder) .
|
-
- HY-134314
-
-
- HY-U00449
-
|
|
RAR/RXR
|
Cancer
|
|
AGN 193109 is a retinoid analog, and acts as a specific and highly effective antagonist of retinoic acid receptors (RARs), with Kds of 2 nM, 2 nM, and 3 nM for RARα, RARβ, and RARγ, respectively. AGN 193109 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. AGN 193109 is the antidote for retinoic acidosis, that ameliorates the skin and mucosal toxicity.
|
-
- HY-U00449R
-
|
|
RAR/RXR
|
Cancer
|
|
AGN 193109 is a retinoid analog, and acts as a specific and highly effective antagonist of retinoic acid receptors (RARs), with Kds of 2 nM, 2 nM, and 3 nM for RARα, RARβ, and RARγ, respectively. AGN 193109 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. AGN 193109 is the antidote for retinoic acidosis, that ameliorates the skin and mucosal toxicity.
|
-
- HY-170993
-
|
|
Antibiotic
Bacterial
|
Infection
Inflammation/Immunology
|
|
Antimicrobial agent-39 (Compound 8i) is an antibiotic that targets 50S ribosomal subunit and inhibits bacterial protein synthesis. Antimicrobial agent-39 disrupts bacterial cell membranes, leads to leakage of cell contents, thereby exhibiting board-spectrum actibacterial activity. Antimicrobial agent-39 targets organic cation transporters (OCTs), accumulates in infected kidneys, thereby ameliorating pyelonephritis in mouse models .
|
-
- HY-N4090R
-
|
|
Reference Standards
Angiotensin-converting Enzyme (ACE)
ERK
MMP
p38 MAPK
|
Cardiovascular Disease
|
|
Vicenin 3 (Standard) is the analytical standard of Vicenin 3. Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC50 = 46.91 μM) that can be isolated from the aerial parts of Desmodium styracifolium. Vicenin 3 ameliorates IL-1β-induced extracellular matrix degradation in SW1353 chondrocytes by regulating the MAPK pathway. Vicenin 3 can be used for the study of osteoarthritis (OA) and hypertension .
|
-
- HY-N1524
-
|
|
Amyloid-β
MDM-2/p53
Apoptosis
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
Quinovic acid is triterpene. Quinovic acid can ameliorate the Amyloid-β burden, p53 expression and cholesterol accumulation by deterring the oxidative stress through upregulating the Nrf2/HO-1 pathway. Quinovic acid can induce cancer cells apoptosis by upregulating death receptor 5 (DR5). Quinovic acid can be used for the researches of cancer, inflammation, metabolic and neurological disease, such as lung cancer and Alzheimer’s disease (AD) .
|
-
- HY-129670
-
-
- HY-N0261R
-
|
|
Reference Standards
TNF Receptor
COX
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Aurantio-obtusin (Standard) is the analytical standard of Aurantio-obtusin. This product is intended for research and analytical applications. Aurantio-obtusin is a anthraquinone compound that can be extracted from cassia seed. Aurantio-obtusin has the effects of decreasing blood pressure, decreasing blood lipids and anti-inflammatory.Aurantio-obtusin is an orally active vasodilator. Aurantio-obtusin ameliorates hepatic steatosis through AMPK/ autophagy-and AMPK/TFEB mediated inhibition of lipid accumulation .
|
-
- HY-B0004R
-
|
|
Reference Standards
Adenosine Receptor
Phosphodiesterase (PDE)
Reactive Oxygen Species (ROS)
|
Inflammation/Immunology
|
|
Doxofylline (Standard) is the analytical standard of Doxofylline. This product is intended for research and analytical applications. Doxofylline is an orally active PDE IV inhibitor and A1AR antagonist. Doxofylline reduces inflammation in epithelial cells via inhibiting mitochondrial ROS production and amelioration of multiple cellular pathways (NLRP3-TXNIP inflammasome activation). Doxophylline can be used in studies of asthma, chronic obstructive pulmonary disease, and bronchospasm .
|
-
- HY-B2246S
-
|
(R)-Carnitine-d9 chloride; Levocarnitine-d9 chloride
|
Isotope-Labeled Compounds
Endogenous Metabolite
|
Metabolic Disease
|
|
L-Carnitine-d9 (chloride)e is the deuterium labeled L-Carnitine chloride. L-Carnitine chloride, a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine chloride functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine chloride is an antioxidant. L-Carnitine chloride can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-100897A
-
|
|
Thrombin
|
Cardiovascular Disease
|
|
Sulodexide solution is a mixture of glycosaminoglycans that can be administered by injection. It is composed of low molecular weight heparin (80%) and dermatan sulfate (20%). Sulodexide exhibits antithrombotic activity through interaction with antithrombin III (AT III) and heparin cofactor II (HC II), and inhibition of thrombin formation. Sulodexide exhibits profibrinolytic activity through release of tissue plasminogen activator (tPA). Sulodexide exhibits endothelial protective and anti-inflammatory effect, ameliorates chronic venous disease.
|
-
- HY-155659
-
|
|
Nuclear Hormone Receptor 4A/NR4A
|
Neurological Disease
|
|
4A7C-301 is a Nurr1 agonist with robust neuroprotective effects in vitro. 4A7C-301 significantly ameliorates neuropathological abnormalities and improves motor and olfactory dysfunctions in AAV2-mediated α-synuclein-overexpressing male mouse models. 4A7C-301 can be used for the research of Parkinson’s disease .
|
-
- HY-158316
-
|
|
Fc Receptor (FcR)
|
Others
|
|
BTL-MK (Compound 19) an orally active antiallergic agent, that inhibits degranulation of mast cells with an IC50 of 6.7 μM, through binding to the inhibitory receptor FcγRIIB. BTL-MK improves the metaboilic stability in human liver microsomes. BTL-MK ameliorates the allergic response in Ovalbumins (HY-W250978)-induced food allergy mice model. BTL-MK exhibits a good pharmacokinetic character with metabolic stability .
|
-
- HY-169007
-
|
|
STAT
|
Inflammation/Immunology
|
|
STAT3-IN-34 (Compound 15E) is an inhibitor for STAT3, and inhibits the nuclear translocation and transcriptional regulator activity of STAT3. STAT3-IN-34 inhibits the proliferation of cell HaCaT with IC50 of 0.008 μM. STAT3-IN-34 inhibits IL-17A expression and ameliorates Imiquimod (HY-B0180)-induced psoriasis in mice .
|
-
- HY-N5159
-
|
|
iGluR
|
Neurological Disease
|
|
Ampullosporin A is a peptaibol-type polypeptide that can be isolated from the fungus Sepedonium ampullosporum HKI-0053, exhibiting neuroleptic-like activity. Ampullosporin A can inhibit hyperactivity induced by NMDA receptor antagonist MK-801 (HY-15084B) and ameliorate social behavior abnormalities caused by subchronic drug treatment. Ampullosporin A alters the activity of glutamate receptors without affecting dopamine D1 and D2 receptors .
|
-
- HY-66008
-
|
N-Acetyl-5-aminosalicylic acid; N-Acetyl-ASA
|
Drug Metabolite
|
Inflammation/Immunology
Cancer
|
|
N-Acetyl mesalazine (N-Acetyl-5-aminosalicylic acid) is the primary intestinal metabolite of 5-Aminosalicylic Acid (HY-15027) and serves as a biomarker for evaluating the efficacy of 5-Aminosalicylic Acid (HY-15027). N-Acetyl mesalazine can scavenge free radicals, reduce DNA base hydroxylation, and ameliorate mucosal inflammation. N-Acetyl mesalazine can be used in the study of diseases such as colitis and colon cancer .
|
-
- HY-105174
-
|
|
JAK
FAK
|
Inflammation/Immunology
|
|
BPC 157 is the 15-amino acide fragment of gastric peptide BPC. BPC 157 exhibits wound healing promoting and neuroprotective activity. BPC 157 maintains the integrity of the gastrointestinal mucosa without significant toxicity. BPC 157 acetate counteracts NSAIDs/insulin overdose/copper-induced toxicity. BPC 157 ameliorates specific (over)stimulated/damaged neurotransmitter systems-induced behavioral disorders through serotonergic and dopaminergic systems .
|
-
- HY-B0399S
-
|
(R)-Carnitine-d9; Levocarnitine-d9
|
Isotope-Labeled Compounds
Endogenous Metabolite
|
Neurological Disease
Metabolic Disease
|
|
L-Carnitine-d9 is the deuterium labeled L-Carnitine. L-Carnitine (Levocarnitine) is an endogenous molecule involved in fatty acid metabolism, biosynthesized within the human body using amino acids: L-lysine and L-methionine, as substrates. L-Carnitine functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-carnitine can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-B1021
-
|
|
Free Fatty Acid Receptor
|
Cardiovascular Disease
Metabolic Disease
|
|
Vincamine is a monoterpenoid indole alkaloid extracted from the Madagascar periwinkle. Vincamine is a peripheral vasodilator and exerts a selective vasoregulator action on the brain microcapilar circulation . Vincamine is a GPR40 agonist and acts as a β-cell protector by ameliorating β-cell dysfunction and promoting glucose-stimulated insulin secretion (GSIS). Vincamine improves glucose homeostasis in vivo, and has the potential for the type 2 diabetes mellitus (T2DM) research .
|
-
- HY-N6973
-
Boldine
1 Publications Verification
|
RANKL/RANK
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
Boldine is an apomorphine isoquinoline alkaloid extracted from the root of the pheasant pepper (Litsea cubeba). Boldine is an oral effective antioxidant, anti-inflammatory, antitumor agent, and can inhibit osteoclast formation. Boldine induces apoptosis of human bladder cancer cells by regulating ERK, AKT and GSK-3β. Boldine ameliorates bone destruction by down-regulating the OPG/RANKL/RANK signaling pathway. It can be used in rheumatoid arthritis research .
|
-
- HY-145041
-
|
|
MAP4K
|
Inflammation/Immunology
Cancer
|
|
HPK1-IN-15 is a potent and selective inhibitor of HPK1. Hematopoietic progenitor kinase 1 (HPKl) originally cloned from hematopoietic progenitor cells is a member of MAP kinase kinase kinase kinases (MAP4Ks) family. HPK1-IN-15 is useful in researching, preventing or ameliorating diseases or disorders associated with HPK1 activity such as cancer (extracted from patent WO2018049200A1, compound 50) .
|
-
- HY-145042
-
|
|
MAP4K
|
Inflammation/Immunology
Cancer
|
|
HPK1-IN-16 is a potent and selective inhibitor of HPK1. Hematopoietic progenitor kinase 1 (HPKl) originally cloned from hematopoietic progenitor cells is a member of MAP kinase kinase kinase kinases (MAP4Ks) family. HPK1-IN-16 is useful in researching, preventing or ameliorating diseases or disorders associated with HPK1 activity such as cancer (extracted from patent WO2019051199A1, compound 39) .
|
-
- HY-178323
-
|
|
5-HT Receptor
Arrestin
|
Neurological Disease
|
|
MW073 is a highly selective and orally active 5-HT2BR antagonist (IC50 =70 nM). MW073 exerts its effects by concentration-dependently inhibiting receptor activity and β-arrestin-1 recruitment. MW073 ameliorates synaptic plasticity and behavioral deficits, including aggression, in Alzheimer’s disease (AD) mouse models. MW073 can be used for Alzheimer’s disease (AD) research [1][2].
|
-
- HY-P1847
-
|
|
NF-κB
|
Cancer
|
|
IKKγ NBD Inhibitory Peptide is a highly specific inhibitor NF-κB inhibitor. IKKγ NBD Inhibitory Peptide acts by disrupting the interaction between IKKγ/NEMO-binding domain (NBD) with IKKα and IKKβ, thus blocking TNF-α-induced NF-kB activation. IKKγ NBD Inhibitory Peptide could significantly suppresses inflammation and ameliorate the cerebral ischemia-induced neurological deficits .
|
-
- HY-B0399R
-
|
(R)-Carnitine (Standard); Levocarnitine (Standard)
|
Reference Standards
Endogenous Metabolite
|
Neurological Disease
Cancer
|
|
L-Carnitine (Standard) is the analytical standard of L-Carnitine. This product is intended for research and analytical applications. L-Carnitine ((R)-Carnitine), a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine is an antioxidant. L-Carnitine can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-P5333A
-
|
UB311 immunogen I acetate
|
Amyloid-β
|
Neurological Disease
|
|
Aβ1-14-εK-KKK-MvF5 Th acetate is the acetate salt form of Aβ1-14-εK-KKK-MvF5 Th (HY-P5333). Aβ1-14-εK-KKK-MvF5 Th acetate is part of UB-311 vaccine, that targets the amyloid-beta (Aβ) protein, and ameliorates the Alzheimer’s disease .
|
-
- HY-145044
-
|
|
MAP4K
|
Inflammation/Immunology
Cancer
|
|
HPK1-IN-17 is a potent and selective inhibitor of HPK1. Hematopoietic progenitor kinase 1 (HPKl) originally cloned from hematopoietic progenitor cells is a member of MAP kinase kinase kinase kinases (MAP4Ks) family. HPK1-IN-17 is useful in researching, preventing or ameliorating diseases or disorders associated with HPK1 activity such as cancer (extracted from patent WO2019238067A1, compound 73) .
|
-
- HY-B2246R
-
|
(R)-Carnitine hydrochloride (Standard); Levocarnitine hydrochloride (Standard)
|
Reference Standards
Endogenous Metabolite
|
Metabolic Disease
Cancer
|
|
L-Carnitine (hydrochloride) (Standard) is the analytical standard of L-Carnitine (hydrochloride). This product is intended for research and analytical applications. L-Carnitine hydrochloride ((R)-Carnitine hydrochloride), a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine hydrochloride functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine hydrochloride is an antioxidant. L-Carnitine hydrochloride can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-P1098B
-
|
|
IKK
|
Inflammation/Immunology
|
|
Ac2-26 ammonium is the N-terminal peptide of annexin 1, and has anti-inflammatory activity. Ac2-26 ammonium induces a decrease in IKKβ protein in lysosomes by chaperone-mediated autophagy (CMA). Ac2-26 ammonium ameliorates lung ischemia-reperfusion injury. Ac2-26 ammonium also inhibits airway inflammation and hyperresponsiveness in an asthma rat model .
|
-
- HY-162710
-
|
|
Aminopeptidase
|
Inflammation/Immunology
|
|
LTA4H-IN-5 (Compound H122) is an orally active inhibitor for leukotriene A4 hydrolase (LTA4H), that inhibits the LTA4H aminopeptidase and LTA4H hydrolase with IC50 of 0.38 nM and 16.93 nM. LTA4H-IN-5 exhibits good pharmacokinetic characteristics in C57 mice and ameliorates the DNBS-induced ulcerative enteritis in rat models .
|
-
- HY-P5875
-
|
|
Protease Activated Receptor (PAR)
|
Cardiovascular Disease
Inflammation/Immunology
|
|
P4pal10 is an antagonist for protease-activated receptor 4 (PAR4). P4pal10 inhibits the platelet aggregation, inhibits tissue factor (TF)-induced thrombin generation, and exhibits anticoagulant and antithrombotic activities. P4pal10 reduces the oedema and the granulocyte infiltration induced by Carrageenan (HY-125474). P4pal10 ameliorates the injury in mice myocardial ischemia/reperfusion (I/R) models .
|
-
- HY-145045
-
|
|
MAP4K
|
Inflammation/Immunology
Cancer
|
|
HPK1-IN-18 is a potent and selective inhibitor of HPK1. Hematopoietic progenitor kinase 1 (HPKl) originally cloned from hematopoietic progenitor cells is a member of MAP kinase kinase kinase kinases (MAP4Ks) family. HPK1-IN-18 is useful in researching, preventing or ameliorating diseases or disorders associated with HPK1 activity such as cancer (extracted from patent WO2019238067A1, compound 1) .
|
-
- HY-134914
-
|
|
Antibiotic
Parasite
|
Infection
|
|
Fosmidomycin is an orally active antibiotic, which exhibits antimalarial activity through inhibition of 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DOXP reductoisomerase). Fosmidomycin inhibits P. falciparum strains 3D7, HB3, Dd2 and A2, with IC50s of 150, 71, 170 and 150 ng/mL, respectively. Fosmidomycin exhibits synergistic effect with Clindamycin (HY-B1455), and ameliorates malaria in mouse model .
|
-
- HY-P1409
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-P1409A
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
ADWX 1 TFA is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 TFA ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 TFA can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-106961A
-
|
(Z)-ONO-AP 500-02
|
Prostaglandin Receptor
|
Cardiovascular Disease
|
|
(Z)-ONO 1301 is the isomer of ONO 1301 (HY-106961), and can be used as an experimental control. ONO 1301 (ONO-AP 500-02), a prostaglandin (PG) I2 mimetic, is an orally active, long-acting prostacyclin agonist with thromboxane-synthase inhibitory activity. ONO 1301 promotes production of hepatocyte growth factor (HGF) from various cell types and ameliorates ischemia-induced left ventricle dysfunction in the mouse, rat and pig .
|
-
- HY-148949A
-
|
|
Kallikrein
|
Others
|
|
Kallikrein 5-IN-2 TFA is the TFA salt form of Kallikrein 5-IN-2 (HY-148949). Kallikrein 5-IN-2 TFA is a selective inhibitor for kallikrein 5 (KLK5) with pIC50 of 7.1. Kallikrein 5-IN-2 TFA is non-phototoxic (100 μg/mL) and non-irritant. Kallikrein 5-IN-2 is stable at pH 4-pH 8 under non-oxidative condition. Kallikrein 5-IN-2 is potent in ameliorating the Netherton syndrome .
|
-
- HY-143312E
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
(S)-V-0219 hydrochloride is an enantiomer of V-0219 (HY-143312). V-0219 is an orally active and positive allosteric modulator (PAM) of the GLP Receptor-1 (GLP-1R). (S)-V-0219 hydrochloride activates calcium fluxes in HEK cells stably expressing hGLP-1R. (S)-V-0219 hydrochloride is orally active and ameliorates high glucose levels in mice and inhibits feeding behavior in fasted mice .
|
-
- HY-143312C
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
(S)-V-0219 is an enantiomer of V-0219 (HY-143312). V-0219 is an orally active and positive allosteric modulator (PAM) of the GLP Receptor-1 (GLP-1R). (S)-V-0219 activates calcium fluxes in HEK cells stably expressing hGLP-1R. (S)-V-0219 is orally active and ameliorates high glucose levels in mice and inhibits feeding behavior in fasted mice .
|
-
- HY-144437
-
|
|
TGF-β Receptor
|
Cancer
|
|
ALK5-IN-9 (Compound 8h) is a potent and orally active inhibitor of TGFβRI (ALK5). ALK5-IN-9 inhibits ALK5 autophosphorylation and NIH3T3 cell activity with IC50 values of 25 nM and 74.6 nM, respectively. ALK5-IN-9 also shows favorable pharmacokinetic profile and ameliorated hERG inhibition. ALK5-IN-9 has the potential for the research of cancer disease .
|
-
- HY-105174A
-
|
|
JAK
FAK
|
Neurological Disease
Metabolic Disease
|
|
BPC 157 acetate is the acetate salt form of BPC 157 (HY-105174). BPC 157 acetate is the 15-amino acide fragment of gastric peptide BPC. BPC 157 acetate exhibits wound healing promoting and neuroprotective activity. BPC 157 acetate maintains the integrity of the gastrointestinal mucosa without significant toxicity. BPC 157 acetate counteracts NSAIDs/insulin overdose/copper-induced toxicity. BPC 157 acetate ameliorates specific (over)stimulated/damaged neurotransmitter systems-induced behavioral disorders through serotonergic and dopaminergic systems .
|
-
- HY-W754236
-
|
|
Isotope-Labeled Compounds
Endogenous Metabolite
|
Metabolic Disease
|
|
(R)-Carnitine Hydrochloride- 13C3 is the 13C-labeled L-Carnitine hydrochloride (HY-B2246). L-Carnitine hydrochloride ((R)-Carnitine hydrochloride), a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine hydrochloride functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine hydrochloride is an antioxidant. L-Carnitine hydrochloride can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-18100AR
-
|
|
Reference Standards
Sigma Receptor
Akt
NO Synthase
|
Cardiovascular Disease
Neurological Disease
|
|
PRE-084 (hydrochloride) (Standard) is the analytical standard of PRE-084 (hydrochloride). This product is intended for research and analytical applications. PRE-084 hydrochloride is a highly selective σ1 receptor (S1R) agonist, with an IC50 of 44 nM. PRE-084 hydrochloride exhibits good neuroprotective effects, can improve motor function and motor neuron survival in mice. PRE-084 hydrochloride also can ameliorate myocardial ischemia-reperfusion injury in rats by activating the Akt-eNOS pathway .
|
-
- HY-100546
-
|
|
Histone Demethylase
|
Infection
Metabolic Disease
Cancer
|
|
GSK-LSD1, a chemical probe, is a LSD1 inhibitor. GSK-LSD1 reduces food intake and body weight, and improves insulin sensitivity and glycemic control in mouse models of obesity. GSK-LSD1 also ameliorates NAFLD. GSK-LSD1 inhibits SARS-CoV-2-triggered cytokine release in COVID-19 PBMCs. GSK-LSD1 also inhibits cancer growth and metastasis .
|
-
- HY-169780
-
|
|
TRP Channel
|
Neurological Disease
Inflammation/Immunology
|
|
(S)-AMG-628 (Compound 16q) is the S-isomer of AMG-628 (HY-123374). (S)-AMG-628 is the orally active antagonist for TRPV1, that inhibits the Capsaicin (HY-10448)- and acid-induced Ca 2+-influx with IC50 of 7 nM and 5 nM in CHO cell. (S)-AMG-628 ameliorates Capsaicin-induced rats flinching, and reverses the thermal hypersensitivity in CFA-(HY-153808) induced inflammatory pain models .
|
-
- HY-N2453R
-
|
|
Reference Standards
PPAR
NF-κB
P-glycoprotein
|
Inflammation/Immunology
Cancer
|
|
Convallatoxin (Standard) is the analytical standard of Convallatoxin. This product is intended for research and analytical applications. Convallatoxin is a cardiac glycoside isolated from Adonis amurensis Regel et Radde. Convallatoxin ameliorates colitic inflammation via activation of PPARγ and suppression of NF-κB. Convallatoxin is a P-glycoprotein (P-gp) substrate and recognized Val982 as an important amino acid involved in its transport. Convallatoxin is an enhancer of ligand-induced MOR endocytosis with high potency and efficacy. Anti-inflammatory and anti-proliferative properties .
|
-
- HY-W016586R
-
|
AT-125 (Standard); U-42126 (Standard)
|
Reference Standards
Parasite
γ-Glutamyl Transferase (GGT)
|
Infection
Cancer
|
|
Articaine (Standard) is the analytical standard of Articaine. This product is intended for research and analytical applications. Articaine (Hoe-045 free base) is an amide agent that can suppress or relieve pain. containing an ester group, reversibly binding to the α-subunit of the voltage-gated sodium channels within the inner cavity of the nerve, can provide effective pain relief. Articaine ameliorates LPS-induced acute kidney injury via inhibition of NF-κB activation and the NLRP3 inflammasome pathway .
|
-
- HY-161520
-
|
|
Glucocorticoid Receptor
NF-κB
|
Inflammation/Immunology
|
|
Glucocorticoid receptor/NF-κB modulator-1 (Compound 20) is a derivative of ocotillol. Glucocorticoid receptor/NF-κB modulator-1 suppresses the degradation of glucocorticoid receptor (GR) mRNA and GR protein, inhibits the activation of NF-κB signaling pathway. Glucocorticoid receptor/NF-κB modulator-1 downregulates levels of NO, interleukin-6 and tumor necrosis factor-alpha (TNF-α). Glucocorticoid receptor/NF-κB modulator-1 ameliorates sepsis in mouse model .
|
-
- HY-146725
-
|
|
FBPase
|
Metabolic Disease
|
|
FBPase-IN-1 is a potent FBPase (Fructose-1,6-bisphosphatase) inhibitor for Type 2 diabetes (T2D) study with an IC50 of 0.22 μM. FBPase-IN-1 can reduce blood glucose levels and ameliorate glucose tolerance. FBPase-IN-1 modifies the C128 site, regulates the N125-S124-S123 allosteric pathway of FBPase and affects the catalytic activity of FBPase .
|
-
- HY-169332
-
|
|
Piezo Channel
ERK
|
Metabolic Disease
|
|
Piezo1 agonist 1-d2 (Compound 12a) is an agonist for Piezo1 with an EC50 of 2.21 μM. Piezo1 agonist 1-d2 activates the Ca 2+-related ERK signaling pathway, and thus promotes the osteogenic differentiation of bone marrow mesenchymal stem cells (BMSCs). Piezo1 agonist 1-d2 ameliorates disuse osteoporosis in the hindlimb-unloading (HU) rat model .
|
-
- HY-P10580
-
|
|
Tie
|
Infection
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
Vasculotide, an angiopoietin-1 mimetic, is a Tie-2 activator and induces Tie-2 phosphorylation. Vasculotide has anti-inflammatiory effect and anti-permeability. Vasculotide ameliorates endotoxin-induced endothelial barrier dysfunction. Vasculotide promotes angiogenesis in a mouse model of diabetic ulcer. Vasculotide protects mice from vascular leakage and reduces mortality in murine abdominal sepsis. Vasculotide decreases microvascular leakage and improves microcirculatory perfusion in a rat model of hemorrhagic shock .
|
-
- HY-N2118
-
|
|
PPAR
PKA
Akt
p38 MAPK
ERK
|
Metabolic Disease
|
|
Bilobetin, an active component of Ginkgo biloba, can reduce blood lipids and improve the effects of insulin. Bilobetin ameliorated insulin resistance, increased the hepatic uptake and oxidation of lipids, reduced very-low-density lipoprotein triglyceride secretion and blood triglyceride levels, enhanced the expression and activity of enzymes involved in β-oxidation and attenuated the accumulation of triglycerides and their metabolites in tissues. Bilobetin also increased the phosphorylation, nuclear translocation and activity of PPARα accompanied by elevated cAMP level and PKA activity .
|
-
- HY-N0236R
-
|
|
Reference Standards
Antibiotic
STAT
|
Infection
Metabolic Disease
Cancer
|
|
Corylin (Standard) is the analytical standard of Corylin. This product is intended for research and analytical applications. Corylin is an orally active flavonoid anti-inflammatory and osteogenic agent that inhibits IL-6-induced STAT3 promoter activity and STAT3 phosphorylation. Corylin also has anticancer, antiatherosclerotic, and ameliorating activity in hyperlipidemia and insulin resistance, inducing adipocyte browning and lipolysis through SIRT1 or β3-AR-dependent pathways .
|
-
- HY-P1847A
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
IKKγ NBD Inhibitory Peptide TFA is a highly specific inhibitor NF-κB inhibitor. IKKγ NBD Inhibitory Peptide TFA acts by disrupting the interaction between IKKγ/NEMO-binding domain (NBD) with IKKα and IKKβ, thus blocking TNF-α-induced NF-kB activation. IKKγ NBD Inhibitory Peptide TFA could significantly suppresses inflammation and ameliorate the cerebral ischemia-induced neurological deficits .
|
-
- HY-114520
-
|
|
Monoamine Oxidase
Mitochondrial Metabolism
Apoptosis
Reactive Oxygen Species (ROS)
|
Neurological Disease
Metabolic Disease
|
|
TT01001 is a selective and orally active mitoNEET agonist and a monoamine oxidase B (MAO-B) inhibitor (IC50 = 8.84 μM). TT01001 does not activate PPARγ but interacts with MitoNEET. TT01001 attenuates oxidative stress and neuronal apoptosis by preventing mitoNEET-mediated mitochondrial dysfunction. TT01001 improves type II diabetes and ameliorates mitochondrial function of mice. TT01001 can used for the studies of type II diabetes and neurological disorders .
|
-
- HY-P99959
-
|
MT-3921; rH116A3
|
TGF-β Receptor
|
Neurological Disease
|
|
Unasnemab (MT-3921) is a humanised IgG1 monoclonal antibody that binds to repulsive guidance molecule A (RGMa). Unasnemab improves locomotor function and promotes neuroregeneration. Unasnemab exerts ameliorative effects on hippocampal neurogenesis impairment and cognitive decline in db/db mice, Streptozotocin (STZ) (HY-13753)-induced type 1 diabetic and bilateral common carotid artery stenosis (BCAS)-induced mice. Unasnemab can be used for the research of spinal cord injury, diabetes-induced neurological impairments .
|
-
- HY-149136
-
|
|
Integrin
TGF-beta/Smad
|
Inflammation/Immunology
|
|
MORF-627 is a selective, orally active inhibitor for integrin αvβ6 with an IC50 of 9.2 nM measuring by human serum ligand binding assay. MORF-627 inhibits αvβ6-mediated TGF-β1 activation with an IC50 of 2.63 nM, inhibits SMAD2/3 phosphorylation with an IC50 of 8.3 nM. MORF-627 ameliorates the Bleomycin (HY-108345)-induced mouse lung fibrosis .
|
-
- HY-B0399G
-
|
(R)-Carnitine; Levocarnitine
|
Endogenous Metabolite
|
Neurological Disease
Cancer
|
|
L-Carnitine (GMP) is L-Carnitine (HY-B0399) produced by using GMP guidelines. GMP small molecules work appropriately as an auxiliary reagent for cell therapy manufacture. L-Carnitine, a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine is an antioxidant. L-Carnitine can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-101390
-
|
(S)-Niguldipine hydrochloride
|
Calcium Channel
|
Cardiovascular Disease
|
|
(+)-Niguldipine hydrochloride is an antagonist for calcium channel. (+)-Niguldipine hydrochloride produces vasodilation by blocking calcium channels and reducing the transmembrane influx of calcium ions. (+)-Niguldipine hydrochloride inhibits U-46619 (HY-108566)-induced coronary vasoconstriction in guinea pig Langendorff heart with pID50 of 11.37, binds to calcium channel on guinea pig skeletal muscle membrane with Ki of 9.75, and lowers the blood pressure in spontaneously hypertensive rat with pED30 of 7.1. (+)-Niguldipine hydrochloride ameliorates cardiovascular diseases such as hypertension, angina pectoris and arrhythmias .
|
-
- HY-164102
-
|
|
TNF Receptor
NF-κB
|
Inflammation/Immunology
|
|
TNF-α-IN-18 (Compound 61) is an inhibitor for TNF-α (IC50 of 1.8 μM), that inhibits TNF signaling pathway through block of NF-kB migration from cytoplasm to nucleus. TNF-α-IN-18 exhibits slight cytotoxicity to mouse fibroblast LM cell, with a CC50 >50 μM. TNF-α-IN-18 ameliorates the TNF- or Lipopolysaccharide (HY-D1056)-induced sepsis in mouse models. TNF-α-IN-18 protects mice from rheumatoid arthritis .
|
-
- HY-14393
-
|
Frangula emodin
|
SARS-CoV
Casein Kinase
Autophagy
11β-HSD
|
Cancer
|
|
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
|
-
- HY-N16066
-
|
CHNQD-0803
|
AMPK
Apoptosis
NF-κB
TNF Receptor
|
Inflammation/Immunology
|
|
Candidusin A (CHNQD-0803) (Compound 4) is a AMPK activator with a KD of 47.28 nM. Candidusin A can be isolated from marine fungus Aspergillus candidus. Candidusin A has cytotoxic activity and induces apoptosis in human prostate cancer cells (22Rv1, PC-3 and LNCaP cells). Candidusin A reduces adipogenesis genes expression and fat deposition, negatively regulates the NF-κB-TNFα inflammatory axis to suppress inflammation, and ameliorates liver injury and fibrosis. Candidusin A can be used for non-alcoholic steatohepatitis (NASH) research .
|
-
- HY-123976A
-
|
|
HDAC
|
Neurological Disease
Cancer
|
|
MPT0G211 mesylate is a potent, orally active and selective HDAC6 inhibitor (IC50=0.291 nM). MPT0G211 mesylate displays >1000-fold selective for HDAC6 over other HDAC isoforms. MPT0G211 mesylate can penetrate the blood-brain barrier. MPT0G211 mesylate ameliorates tau phosphorylation and cognitive deficits in an Alzheimer’s disease model. MPT0G211 mesylate has anti-metastatic and neuroprotective effects. Anticancer activities .
|
-
- HY-U00449A
-
|
|
RAR/RXR
|
Cancer
|
|
AGN 193109 sodium is the sodium salt form of AGN 193109 (HY-U00449). AGN 193109 sodium is the pan antagonist for retinoic acid receptor (RAR), with Kd of 2, 2 and 3 nM, for RARα, RARβ and RARγ, respectively. AGN 193109 sodium reverses TTNPB-induced morphology changes and all-trans retinoic acid (tRA)/9-cis RA/13-cis RA-induced proliferation suppression in ECE16-1 cell. AGN 193109 sodium is the antidote for retinoic acidosis, that ameliorates the skin and mucosal toxicity .
|
-
- HY-129440R
-
|
|
PDGFR
ERK
Caspase
|
Metabolic Disease
Inflammation/Immunology
|
|
N-(p-Coumaroyl) Serotonin (Standard) is the analytical standard of N-(p-Coumaroyl) Serotonin. This product is intended for research and analytical applications. N-(p-Coumaroyl) Serotonin is a polyphenol isolated from the seeds of safflower and has antioxidative, anti-atherogenic and anti-inflammatory properties. N-(p-Coumaroyl) Serotonin inhibits PDGF-induced on phosphorylation of PDGF receptor and Ca2+ release from sarcoplasmic reticulum . N-(p-Coumaroyl) Serotonin ameliorates atherosclerosis and distensibility of the aortic wall in vivo and is usually used for the atherosclerosis research .
|
-
- HY-U00449G
-
|
|
RAR/RXR
|
Cancer
|
|
AGN 193109 (GMP) is AGN 193109 (HY-U00449) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. AGN 193109 is a specific and highly effective retinoic acid receptor (RAR) antagonist . AGN 193109 (GMP) is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. AGN 193109 is the antidote for retinoic acidosis, that ameliorates the skin and mucosal toxicity.
|
-
- HY-168731
-
|
|
Cholinesterase (ChE)
|
Neurological Disease
|
|
AChE/BChE-IN-25 (Compound 6e) is the orally active inhibitor for hAChE and eqBChE with IC50 of 7.9 nM and 0.79 nM. AChE/BChE-IN-25 exhibits antioxidant activity, that scavenges free radical with IC50 of 22.91 μM. AChE/BChE-IN-25 exhibits neuroprotective effects by reducing mitochondrial and cellular oxidative stress in the Drosophila Alzheimer's disease model. AChE/BChE-IN-25 ameliorates Scopolamine (HY-N0296)-induced spatial and cognitive memory impairment in mouse model .
|
-
- HY-B0399S2
-
|
(R)-Carnitine-13C3; Levocarnitine-13C3
|
Isotope-Labeled Compounds
Endogenous Metabolite
|
Neurological Disease
Cancer
|
|
L-Carnitine- 13C3 ((R)-Carnitine- 13C3) is the 13C--labeled L-Carnitine (HY-B0399). L-Carnitine ((R)-Carnitine), a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine is an antioxidant. L-Carnitine can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-100897
-
|
|
Thrombin
|
Cardiovascular Disease
|
|
Sulodexide is a mixture of glycosaminoglycans available in soft capsule form for oral administration. It is composed of low molecular weight heparin (80%) and dermatan sulfate (20%). Sulodexide exhibits antithrombotic activity through interaction with antithrombin III (AT III) and heparin cofactor II (HC II), and inhibition of thrombin formation. Sulodexide exhibits profibrinolytic activity through release of tissue plasminogen activator (tPA). Sulodexide exhibits endothelial protective and anti-inflammatory effect, ameliorates chronic venous disease .
Sulodexide is a glycosaminoglycan mixture available in soft gelatin capsule form for oral administration.
|
-
- HY-161643
-
|
|
Cholinesterase (ChE)
Keap1-Nrf2
|
Neurological Disease
Inflammation/Immunology
|
|
S21-1011 is a selective inhibitor for butyrylcholinesterase (BChE), with IC50 of 0.059 and 0.162 μM, for eqBChE and hBChE, respectively. S21-1011 exhibits good blood-brain barrier (BBB) permeability and good pharmacokinetic characters. S21-1011 exhibits anti-inflammatory activity through activation of keap1-Nrf2-ARE pathway (EC50 is 23.48 μM for antioxidant element ARE activation), ameliorates cognitive impairment in murine Alzheimer’s disease model .
|
-
- HY-172409
-
|
|
Cannabinoid Receptor
p38 MAPK
NF-κB
|
Inflammation/Immunology
|
|
CB1R antagonist 2 (Compound 11g) is the antagonist for cannabinoid receptor 1 (CB1R), that inhibits MAPK/NF-κB signaling pathway and exhibits anti-inflammatory activity. CB1R antagonist 2 inhibits LPS (HY-D1056)-induced IL-6, IL-1β and TNF-α expressions in RAW264.7. CB1R antagonist 2 ameliorates OVA-induced allergic rhinitis in mouse models .
|
-
- HY-W105518R
-
|
|
Reference Standards
Endogenous Metabolite
|
Neurological Disease
|
|
L-Carnitine (tartrate) (Standard) is the analytical standard of L-Carnitine (tartrate). This product is intended for research and analytical applications. L-Carnitine tartrate is a highly polar, small zwitterion. L-Carnitine tartrate is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine tartrate functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine tartrate is an antioxidant. L-Carnitine tartrate can ameliorate metabolic imbalances in many inborn errors of metabolism [3] .
|
-
- HY-N0202R
-
|
Asterolide (Standard)
|
ERK
Reference Standards
Apoptosis
p38 MAPK
Src
Akt
STAT
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
Cancer
|
|
Atractylenolide II (Standard) is the analytical standard of Atractylenolide II. This product is intended for research and analytical applications. Atractylenolide II (Asterolide) is a sesquiterpenoid compound. Atractylenolide II can induce G1 phase cell cycle arrest and apoptosis in B16 melanoma cells. Atractylenolide II is an orally effective anticancer agent that can exert anti-melanoma effects by inhibiting the STAT3 signaling pathway. In addition, Atractylenolide II has been shown to ameliorate myocardial fibrosis, oxidative stress, and neuroprotective activity .
|
-
- HY-170583
-
|
|
Cholinesterase (ChE)
Amyloid-β
|
Neurological Disease
|
|
hAChE-IN-10 (Compound ET11) is the inhibitor for human acetylcholinesterase (AChE) with an IC50 of 6.34 nM. hAChE-IN-10 scavenges free radicals, and exhibits antioxidant activity. hAChE-IN-10 exhibits metal chelating activity, inhibits Cu 2+-induced Aβ1-42 aggregation, reduces the formation of amyloid plaques, and exhibits neuroprotective activity. hAChE-IN-10 ameliorates the Scopolamine (HY-N0296)-induced cognitive impairment in mouse models .
|
-
- HY-B0987
-
|
L-Ascorbic acid 6-hexadecanoate; 6-O-Palmitoyl-L-ascorbic acid
|
Reactive Oxygen Species (ROS)
Endogenous Metabolite
Calcium Channel
Sodium Channel
Apoptosis
NOD-like Receptor (NLR)
Bcl-2 Family
Caspase
|
Inflammation/Immunology
|
|
Ascorbyl palmitate is an orally active ester formed from ascorbic acid and palmitic acid, used as an antioxidant and food additive. Ascorbyl palmitate in preventing fat and oil oxidation is more efficient than Butylated hydroxyanisole (HY-B1066) and Butylated hydroxytoluene (HY-Y0172). Ascorbyl palmitate mitigates inhibition of collagen synthesis by select calcium and sodium channel blockers. Ascorbyl palmitate induces Apoptosis in human umbilical vein endothelial cells (HUVECs). Ascorbyl palmitate ameliorates inflammatory diseases by inhibition of NLRP3 inflammasome .
|
-
- HY-123976
-
|
|
HDAC
|
Neurological Disease
Cancer
|
|
MPT0G211 is a potent, orally active and selective HDAC6 inhibitor (IC50=0.291 nM). MPT0G211 displays >1000-fold selective for HDAC6 over other HDAC isoforms. MPT0G211 can penetrate the blood-brain barrier. MPT0G211 ameliorates tau phosphorylation and cognitive deficits in an Alzheimer’s disease model. MPT0G211 has anti-metastatic and neuroprotective effects. Anticancer activities .
|
-
- HY-138830A
-
|
|
Histone Demethylase
|
Neurological Disease
|
|
(S,S)-TAK-418 is a potent inhibitor of lysine-specific demethylase 1 (LSD1), demonstrating significant normalization of aberrant gene expression in neurodevelopmental disorders. (S,S)-TAK-418 also ameliorates ASD-like behaviors in rodent models affected by maternal exposure to valproate or poly I:C. (S,S)-TAK-418 modulates gene expression differently across various models and ages, indicating its potential as a therapeutic agent for conditions like autism spectrum disorder and schizophrenia.
|
-
- HY-P1120A
-
|
|
Formyl Peptide Receptor (FPR)
PERK
Apoptosis
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
WKYMVm (TFA) is a selective formylpeptide receptor 2 (FPR2) agonist. WKYMVm has a powerful anti-inflammatory effect that can reduce lung injury and spinal cord injury. WKYMVm ameliorates obesity by regulating lipid metabolism and leptin signaling. WKYMVm is involved in the regulation of immune cells by activating FPRs, and WKYMVm can promote the chemotactic migration of immune cells and inhibit the apoptosis of phagocytes. In addition, WKYMVm may play a favorable or unfavorable role in tumors, depending on the type of tumor .
|
-
- HY-163765
-
|
|
PI4K
Potassium Channel
|
Infection
|
|
Antimalarial agent 41 (Compound 17) exhibits antimalarial activity, which inhibits Plasmodium falciparum with an IC50 of 40 nM (NF54 strain) and 76 nM (K1 strain). Antimalarial agent 41 is an inhibitor for P. falciparum phosphatidylinositol-4-kinase β (Pf PI4K) and hERG channel, with an IC50 of 53 nM and 3 μM. Antimalarial agent 41 exhibits cytotoxicity to CHO cells with an IC50 of 34 μM. Antimalarial agent 41 ameliorates the malaria infection and exhibits good pharmacokinetic characters in mouse models .
|
-
- HY-P10580A
-
|
|
Tie
|
Infection
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
Vasculotide TFA, an angiopoietin-1 mimetic, is a Tie-2 activator and induces Tie-2 phosphorylation. Vasculotide has anti-inflammatiory effect and anti-permeability. Vasculotide TFA ameliorates endotoxin-induced endothelial barrier dysfunction. Vasculotide TFA promotes angiogenesis in a mouse model of diabetic ulcer. Vasculotide TFA protects mice from vascular leakage and reduces mortality in murine abdominal sepsis. Vasculotide TFA decreases microvascular leakage and improves microcirculatory perfusion in a rat model of hemorrhagic shock .
|
-
- HY-59291
-
|
N-Acetyl-L-leucine
|
Amino Acid Derivatives
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
|
|
Levacetylleucine (N-acetyl-L-leucine), an orally bioavailable and brain-penetrant compound, is an acetylated derivative of amino acid Leucine. Levacetylleucine is the active form of N-acetyl-leucine (NAL). Levacetylleucine attenuates neuronal death and neuroinflammation in the cortical tissue of mice. Levacetylleucine also potentially improves ameliorates lysosomal and metabolic dysfunction. Levacetylleucine improves compensation of postural symptoms after unilateral chemical labyrinthectomy (UL) in rats. Levacetylleucine is promising for research of neurological manifestations of Niemann-Pick disease type C, traumatic brain injury and neurodegeneration prevention .
|
-
- HY-P1844
-
|
|
Chemerin Receptor
Akt
ERK
Reactive Oxygen Species (ROS)
Amyloid-β
|
Inflammation/Immunology
|
|
Chemerin-9 (149-157) is a potent agonist of chemokine-like receptor 1 (CMKLR1) . Chemerin-9 (149-157) has anti-inflammatory activity. Chemerin-9 (149-157) stimulates phosphorylation of Akt and ERK as well as ROS production. Chemerin-9 (149-157) ameliorates Aβ1-42-induced memory impairmen. Chemerin-9 (149-157) regulates immune responses, adipocyte differentiation, and glucose metabolism .
|
-
- HY-161784
-
|
|
GABA Receptor
|
Neurological Disease
|
|
GABAA receptor modulator-5 (Compound S28) is a modulator for (γ-aminobutyric acid)A receptor (GABAA receptor), with EC50 of 56 nM and 10 nM, for α1β2γ2 and α4β3δ subtype. GABAA receptor modulator-5 exhibits good pharmacokinetic characteristics in rats. GABAA receptor modulator-5 is slightly toxic toxicity in rats with a loss of rollover reflex (LORR) threshold dose of 23.3 μmol/kg, and exhibits potential ameliorating the postpartum depression .
|
-
- HY-P1120
-
|
|
Formyl Peptide Receptor (FPR)
PERK
Apoptosis
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
WKYMVm is a selective formylpeptide receptor 2 (FPR2) agonist. WKYMVm has a powerful anti-inflammatory effect that can reduce lung injury and spinal cord injury. WKYMVm ameliorates obesity by regulating lipid metabolism and leptin signaling. WKYMVm is involved in the regulation of immune cells by activating FPRs. WKYMVm can promote the chemotactic migration of immune cells and inhibit the apoptosis of phagocytes. In addition, WKYMVm may play a favorable or unfavorable role in tumors, depending on the type of tumor .
|
-
- HY-172171
-
|
|
GSK-3
β-catenin
Wnt
|
Neurological Disease
|
|
GSK3β-IN-2 (Compound S01) is the inhibitor for GSK3β with an IC50 of 0.35 nM. GSK3β-IN-2 activates Wnt/β-catenin signaling pathway, promotes neurogenesis and neurite growth. GSK3β-IN-2 inhibits Aβ-induced tau hyperphosphorylation at Ser396, reduces the formation of neurofibrillary tangles. GSK3β-IN-2 ameliorates Alzheimer's Disease in zebrafish model .
|
-
- HY-173267
-
|
|
Carboxylesterase (CES)
|
Metabolic Disease
Cancer
|
|
CES2A-IN-2 (compound 14n) is an orally active, highly specific, irreversible and covalent CES2A inhibitor with an IC50 of 0.04 nM for human CES2A. CES2A-IN-2 covalently binds to CES2A by specifically targeting the catalytic serine residue (Ser-228). CES2A-IN-2 can significantly ameliorate Irinotecan-triggered gut toxicity (ITGT) without diminishing the anti-tumor effects of Irinotecan (HY-16562) in tumor-bearing mice .
|
-
- HY-P1844A
-
|
|
Chemerin Receptor
Akt
ERK
Reactive Oxygen Species (ROS)
Amyloid-β
|
Inflammation/Immunology
|
|
Chemerin-9 (149-157) TFA is a potent agonist of chemokine-like receptor 1 (CMKLR1) . Chemerin-9 (149-157) TFA has anti-inflammatory activity. Chemerin-9 (149-157) TFA stimulates phosphorylation of Akt and ERK as well as ROS production. Chemerin-9 (149-157) TFA ameliorates Aβ1-42-induced memory impairmen. Chemerin-9 (149-157) TFA regulates immune responses, adipocyte differentiation, and glucose metabolism .
|
-
- HY-119799
-
|
|
Phosphodiesterase (PDE)
|
Inflammation/Immunology
|
|
UK-500001 is an orally active inhibitor for phosphodiesterase 4 (PDE4), which inhibits PDE4D3 (IC50 is 0.28 nM), PDE4B2 (IC50 is 22.8 nM), PDE4A4 (IC50 is 26.1 nM) and PDE4C2 (IC50 is 271 nM). UK-500001 exhibits anti-inflammatory efficacy and inhibits TNF-α and IFN-γ release in human and rodent macrophagic cell lines in nanomolar levels. UK-500001 ameliorates chronic obstructive pulmonary disease (COPD) and asthma .
|
-
- HY-W011012S1
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
Adenosine 5'-monophosphate-d2 disodium is the deuterium labeled Adenosine 5'-monophosphate (HY-W011012). Adenosine 5'-monophosphate disodium is an orally active purine nucleotide, and participates in ATP metabolism. Adenosine 5'-monophosphate disodium is also a ligand for adenosine 2B receptor. Adenosine 5'-monophosphate disodium can activate AMPK in skeletal muscle, and ameliorates insulin resistance and impaired glucose metabolism. Adenosine 5'-monophosphate disodium can be used for research of diabetes .
|
-
- HY-N0755
-
|
|
Insulin Receptor
GLUT
NF-κB
p38 MAPK
Autophagy
|
Metabolic Disease
Endocrinology
Cancer
|
|
Rhoifolin is a flavone glycoside can be isolated from Rhus succedanea. Rhoifolin has anti-diabetic effect acting through enhanced adiponectin secretion, tyrosine phosphorylation of insulin receptor-β and glucose transporter 4 (GLUT 4) translocation. Rhoifolin has an anti-inflammatory action via multi-level regulation of inflammatory mediators. Rhoifolin ameliorates titanium particle-stimulated osteolysis and attenuates osteoclastogenesis via RANKL-induced NF-κB and MAPK pathways. Rhoifolin also has cytotoxic activity against different cancer cell lines .
|
-
- HY-135359R
-
|
|
Drug Metabolite
Reference Standards
|
Neurological Disease
|
|
Adenosine 5'-monophosphate (disodium) (Standard) is the analytical standard of Adenosine 5'-monophosphate (disodium). This product is intended for research and analytical applications. Adenosine 5'-monophosphate disodium is an orally active purine nucleotide, and participates in ATP metabolism. Adenosine 5'-monophosphate disodium is also a ligand for adenosine 2B receptor. Adenosine 5'-monophosphate disodium can activate AMPK in skeletal muscle, and ameliorates insulin resistance and impaired glucose metabolism. Adenosine 5'-monophosphate disodium can be used for research of diabetes .
|
-
- HY-120000
-
MS402
1 Publications Verification
|
Epigenetic Reader Domain
|
Inflammation/Immunology
Cancer
|
|
MS402 is a BD1-selective BET BrD inhibitor with Kis of 77 nM, 718 nM, 110 nM, 200 nM, 83 nM, and 240 nM for BRD4(BD1), BRD4(BD2), BRD3(BD1), BRD3(BD2), BRD2(BD1) and BRD2(BD2), respectively. MS402 blocks Th17 cell differentiation and ameliorates colitis in mice .
|
-
- HY-B1021R
-
|
|
Reference Standards
Free Fatty Acid Receptor
|
Cardiovascular Disease
Metabolic Disease
|
|
Vincamine (Standard) is the analytical standard of Vincamine. This product is intended for research and analytical applications. Vincamine is a monoterpenoid indole alkaloid extracted from the Madagascar periwinkle. Vincamine is a peripheral vasodilator and exerts a selective vasoregulator action on the brain microcapilar circulation . Vincamine is a GPR40 agonist and acts as a β-cell protector by ameliorating β-cell dysfunction and promoting glucose-stimulated insulin secretion (GSIS). Vincamine improves glucose homeostasis in vivo, and has the potential for the type 2 diabetes mellitus (T2DM) research .
|
-
- HY-19522C
-
|
MBX-8025 Lysine dihydrate; RWJ-800025 Lysine dihydrate
|
PPAR
|
Metabolic Disease
|
|
Seladelpar (MBX-8025) Lysine dihydrate is the Lysine dihydrate salt form of Seladelpar (HY-19522). Seladelpar Lysine dihydrate is an orally active agonist for potent PPAR-δ, with EC50 of 2 nM. Seladelpar Lysine dihydrate shows more than 750-fold and 2500-fold selectivity over the PPARα and PPARγ receptors, respectively. Seladelpar Lysine dihydrate can be used for the study of primary biliary cholangitis. Seladelpar Lysine dihydrate normalizes hyperglycemia, hyperinsulinemia, glucose, serum lipids and cholesterol levels, ameliorates the nonalcoholic steatohepatitis in mouse model .
|
-
- HY-N1940
-
|
Cycloicaritin
|
Interleukin Related
TNF Receptor
MMP
|
Inflammation/Immunology
Cancer
|
|
β-Anhydroicaritin is isolated from Boswellia carterii Birdware, has important biological and pharmacological effects, such as antiosteoporosis, estrogen regulation and antitumor properties . β-Anhydroicaritin ameliorates the degradation of periodontal tissue and inhibits the synthesis and secretion of TNF-α and MMP-3 in diabetic rats . β-Anhydroicaritin decreases the overproduction of NO, IL-10, TNF-α, MCP-1 and IL-6 in inperitonitis mice. β-Anhydroicaritin inhibits the elevation of intracellular Ca 2+, and markedly decreases iNOS protein expression .
|
-
- HY-10109A
-
|
|
PI3K
Akt
|
Inflammation/Immunology
|
|
AS-605240 (potassium) is an orally active PI3Kγ inhibitor (IC50: 8 nM; Ki: 7.8 nM). AS-605240 (potassium) inhibits MCP-1- and CSF1-induced PKB phosphorylation (IC50 values are 0.181 and 0.550 µM, respectively). AS-605240 (potassium) reduces neutrophil recruitment in RANTES (CCL5)- and thioglycolate-induced peritonitis mouse models (EC50 values are 9.1 and 10 mg/kg, respectively). AS-605240 (potassium) ameliorates αCII-IA-induced arthritis in mice .
|
-
- HY-N2118R
-
|
|
Reference Standards
PPAR
PKA
Akt
p38 MAPK
ERK
|
Metabolic Disease
|
|
Bilobetin (Standard) is the analytical standard of Bilobetin. This product is intended for research and analytical applications. Bilobetin, an active component of Ginkgo biloba, can reduce blood lipids and improve the effects of insulin. Bilobetin ameliorated insulin resistance, increased the hepatic uptake and oxidation of lipids, reduced very-low-density lipoprotein triglyceride secretion and blood triglyceride levels, enhanced the expression and activity of enzymes involved in β-oxidation and attenuated the accumulation of triglycerides and their metabolites in tissues. Bilobetin also increased the phosphorylation, nuclear translocation and activity of PPARα accompanied by elevated cAMP level and PKA activity .
|
-
- HY-W011012S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
Adenosine 5'-monophosphate- 13C (disodium) is a 13C-labeled Adenosine 5'-monophosphate (HY-W011012). Adenosine 5'-monophosphate disodium is an orally active purine nucleotide, and participates in ATP metabolism. Adenosine 5'-monophosphate disodium is also a ligand for adenosine 2B receptor. Adenosine 5'-monophosphate disodium can activate AMPK in skeletal muscle, and ameliorates insulin resistance and impaired glucose metabolism. Adenosine 5'-monophosphate disodium can be used for research of diabetes .
|
-
- HY-W011012R
-
|
|
Reference Standards
Adenosine Receptor
|
Metabolic Disease
|
|
Adenosine 5'-monophosphate (disodium) (Standard) is the analytical standard of Adenosine 5'-monophosphate (disodium). This product is intended for research and analytical applications. Adenosine 5'-monophosphate disodium is an orally active purine nucleotide, and participates in ATP metabolism. Adenosine 5'-monophosphate disodium is also a ligand for adenosine 2B receptor. Adenosine 5'-monophosphate disodium can activate AMPK in skeletal muscle, and ameliorates insulin resistance and impaired glucose metabolism. Adenosine 5'-monophosphate disodium can be used for research of diabetes .
|
-
- HY-162760
-
|
|
COMT
Monoamine Oxidase
|
Neurological Disease
|
|
COMT-IN-1 (compound C12), a nitrophenolic analogue, is an orally active dopamine metabolic enzyme catechol-O-methyltransferase (COMT) inhibitor with IC50s of 0.37 μM, 95.58 μM and 58.82 μM for COMT, MAO-A and MAO-B, respectively. COMT-IN-1 exhibits chelation with a variety of metal ions. COMT-IN-1 exhibits good BBB permeability. COMT-IN-1 improves dopamine levels and ameliorates MPTP (HY-15608)-induced Parkinson's disease (PD) symptoms in mice .
|
-
- HY-N6711
-
|
|
HIV Integrase
Bacterial
Antibiotic
Reactive Oxygen Species (ROS)
STAT
AMPK
11β-HSD
|
Infection
Metabolic Disease
|
|
Equisetin is an N-methylserine-derived acyl tetramic acid, quorum sensing inhibitor (QSI), herbicides and antibiotics. Equisetin specifically inhibits the anionic carriers of substrates in the inner mitochondrial membrane. Equisetin inhibits the activity of HIV-1 integrase, 11β-HSD1, and 2,4-dinitrophenol (Dnp)-stimulated ATPase (IC50 = ~8 nmol per mg of protein). Equisetin exhibits growth inhibition of bacteria, anti-inflammatory, amelioration of lipid-associated disorders, and cytotoxic effects .
|
-
- HY-P990116
-
|
|
Osteopontin
|
Inflammation/Immunology
|
|
Anti-Mouse osteopontin/SPP1 Antibody (103D6) is a mouse-derived anti-mouse osteopontin/SPP1 IgG2c κ type antibody inhibitor. Anti-Mouse osteopontin/SPP1 Antibody (103D6) increases cytotoxic T lymphocyte lytic activity and suppresses colon tumor growth. Anti-Mouse osteopontin/SPP1 Antibody (103D6) ameliorates liver injury in common bile duct ligation (CBDL)-induced primary sclerosing cholangitis mice models .
|
-
- HY-173488
-
|
|
NF-κB
HIF/HIF Prolyl-Hydroxylase
Keap1-Nrf2
|
Cancer
|
|
NF-κB/HIF-1α-IN-1 (compound 9c) is a potent blocker of the NF-κB activation pathway and demonstrates selective anti-fibrotic activity. NF-κB/HIF-1α-IN-1 shows no significant cytotoxicity in NCI tumor cell lines. In rat models. NF-κB/HIF-1α-IN-1 has been shown to effectively ameliorate liver fibrosis by inhibiting the expression levels of NF-κB and HIF-1α, while simultaneously inducing the activation of Nrf2 .
|
-
- HY-162729
-
|
|
Histone Demethylase
Monoamine Oxidase
TGF-beta/Smad
|
Cardiovascular Disease
|
|
LSD1-IN-34 (Compound 7d) is the orally active inhibitor for Lysine-specific demethylase (LSD) and monoamine oxidase (MAO), with IC50 of 4.51 and 18.46 nM, for LSD1 and MAO A. LSD1-IN-34 inhibits the Ang II-induced neonatal rat myocardial fibroblasts (NRCFs) activation, without significant toxicity (20 μM). LSD1-IN-34 inhibits TGFβ/Smad signaling pathway, and ameliorates heart failure in mice. LSD1-IN-34 exhibits good pharmacokinetic characteristics in rats .
|
-
- HY-162963
-
|
|
PPAR
|
Inflammation/Immunology
|
|
PPARδ agonist 11 (Compound 11) is a selective agonist for PPARδ with an EC50 of 20 nM. PPARδ agonist 11 reduces the levels of nitrite oxide (NO), proinflammatory cytokines TNFα and IL-6 in LPS (HY-D1056)-stimulated RAW264.7 cell, and exhibits anti-inflammatory efficacy via NF-κB pathway. PPARδ agonist 11 exhibits good stability in human liver microsomes and plasma. PPARδ agonist 11 ameliorates Carrageenan (HY-125474)-induced foot edema .
|
-
- HY-14393S
-
|
Frangula emodin-d4
|
Isotope-Labeled Compounds
SARS-CoV
Casein Kinase
Autophagy
11β-HSD
|
Cancer
|
|
Emodin-d4 is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
|
-
- HY-172883
-
|
|
FABP
PPAR
|
Metabolic Disease
Inflammation/Immunology
|
|
ABP/PPAR modulator 1 is an orally active FABP and PPAR multiple modulator (IC50s of 0.65 μM and 1.08 μM for FABP1 and FABP4, EC50 s of 9.19 μM, 2.20 μM and 1.58 μM for PPARα, PPARγ and PPARδ). ABP/PPAR modulator 1 has potent anti-metabolic dysfunction-associated steatohepatitis (MASH) activity. ABP/PPAR modulator 1 dose-dependently ameliorates multiple pathological characteristics of fatty liver in WD + Carbon tetrachloride-induced MASH mice model .
|
-
- HY-170218
-
|
|
NOD-like Receptor (NLR)
Interleukin Related
NF-κB
NO Synthase
|
Inflammation/Immunology
|
|
NLRP3-IN-76 is an orally active NLRP3 inhibitor. NLRP3-IN-76 inhibits the production of NO, and the mRNA levels of proinflammatory cytokines (iNOS, IL-6, IL-1β and TNFα). NLRP3-IN-76 shows anti-inflammatory effects by inhibiting the activation of the NLRP3 inflammasome and NF-κB signaling pathway. NLRP3-IN-76 ameliorates DSS (HY-116282C)-induced colitis and can be used for research of inflammatory bowel diseases (IBD) .
|
-
- HY-16561
-
|
trans-Resveratrol; SRT501
|
IKK
Autophagy
Mitophagy
Sirtuin
Apoptosis
Bacterial
Fungal
Antibiotic
Keap1-Nrf2
|
Infection
Inflammation/Immunology
Cancer
|
|
Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
-
- HY-114911
-
|
DA2370; Prenazone; Zepelin
|
COX
Reactive Oxygen Species (ROS)
MMP
|
Inflammation/Immunology
|
|
Feprazone (DA2370; Prenazone), an analogue of Phenylbutazone (HY-B0230), is a nonsteroidal anti-inflammatory agent with analgesic and antipyretic activities. Feprazone acts by inhibiting the activity of cyclooxygenase (COX)-2. Feprazone ameliorates free fatty acid (FFA)-induced oxidative stress by reducing the production of mitochondrial reactive oxygen species (ROS). Feprazone can decrease the expression of MMP-2 and MMP-9. Besides, Feprazone can suppress adipogenesis and increase lipolysis in differentiating 3 T3-L1 cells. Feprazone also can be used to research atherosclerosis and obesity .
|
-
- HY-163909
-
|
|
Cholinesterase (ChE)
|
Neurological Disease
|
|
AChE-IN-72 (Compound 13a) is an inhibitor for acetylcholinesterase (AChE) with an IC50 of 0.59 μM. AChE-IN-72 inhibits BChE with an IC50 of 5.02 μM. AChE-IN-72 exhibits radical scavenging with IC50 of 5.88 μM. AChE-IN-72 exhibits iron-chelating property, inhibits Aβ1−42 aggregation, and inhibits NLRP3 inflammasome activation. AChE-IN-72 ameliorates memory impairment in Betaine (HY-B0710)-induced AD mouse model. AChE-IN-72 is blood-brain barrier (BBB) penetrable .
|
-
- HY-P5875A
-
|
|
Protease Activated Receptor (PAR)
|
Cardiovascular Disease
Inflammation/Immunology
|
|
P4pal10 TFA is the TFA salt form of P4pal10 (HY-P5875). P4pal10 TFA is an antagonist for protease-activated receptor 4 (PAR4). P4pal10 TFA inhibits the platelet aggregation, inhibits tissue factor (TF)-induced thrombin generation, and exhibits anticoagulant and antithrombotic activities. P4pal10 TFA reduces the oedema and the granulocyte infiltration induced by Carrageenan (HY-125474). P4pal10 TFA ameliorates the injury in rats myocardial ischemia/reperfusion (I/R) models .
|
-
- HY-66008S2
-
|
N-Acetyl-5-aminosalicylic acid-13C6; N-Acetyl-ASA-13C6
|
Isotope-Labeled Compounds
Drug Metabolite
|
Inflammation/Immunology
Cancer
|
|
N-Acetyl mesalazine- 13C6 (N-Acetyl-5-aminosalicylic acid- 13C6) is a deuterated labeled N-Acetyl mesalazine (HY-66008). N-Acetyl mesalazine (N-Acetyl-5-aminosalicylic acid) is the primary intestinal metabolite of 5-Aminosalicylic Acid (HY-15027) and serves as a biomarker for evaluating the efficacy of 5-Aminosalicylic Acid (HY-15027). N-Acetyl mesalazine can scavenge free radicals, reduce DNA base hydroxylation, and ameliorate mucosal inflammation. N-Acetyl mesalazine can be used in the study of diseases such as colitis and colon cancer .
|
-
- HY-66008S1
-
|
N-Acetyl-5-aminosalicylic acid-d3-1; N-Acetyl-ASA-d3-1
|
Isotope-Labeled Compounds
Drug Metabolite
|
Inflammation/Immunology
Cancer
|
|
N-Acetyl mesalazine-d3-1 (N-Acetyl-5-aminosalicylic acid-d3-1) is deuterium labeled N-Acetyl mesalazine (HY-66008). N-Acetyl mesalazine (N-Acetyl-5-aminosalicylic acid) is the primary intestinal metabolite of 5-Aminosalicylic Acid (HY-15027) and serves as a biomarker for evaluating the efficacy of 5-Aminosalicylic Acid (HY-15027). N-Acetyl mesalazine can scavenge free radicals, reduce DNA base hydroxylation, and ameliorate mucosal inflammation. N-Acetyl mesalazine can be used in the study of diseases such as colitis and colon cancer .
|
-
- HY-P11114
-
|
|
Bacterial
p38 MAPK
Reactive Oxygen Species (ROS)
Apoptosis
Caspase
|
Inflammation/Immunology
|
|
Periplanetasin-4 is an antimicrobial peptide that can be derived from the American cockroach (Periplaneta americana). Periplanetasin-4 reduces cell rounding and apoptosis. Periplanetasin-4 blocks Clostridium difficile toxin A-induced ROS production and the activation of downstream p38 MAPK and p21. Periplanetasin-4 significantly increases mitochondrial calcium level, reduces DPH fluorescence intensity and vacuolar dysfunction in Candida albicans ATCC 90028 cells. Periplanetasin-4 significantly ameliorates toxin A-induced mucosal damage in the mouse gut. Periplanetasin-4 can be used for the study of colitis .
|
-
- HY-168207
-
|
|
Toll-like Receptor (TLR)
NF-κB
|
Inflammation/Immunology
|
|
TH023 is an inhibitor for the TLR4 signaling pathway, that targets especially the formation of TLR4 homodimer. TH023 inhibits secreted embryonic alkaline phosphatase in cell HEK-Blue hTLR4 with an IC50 of 0.354 μM, and inhibits the NO expression in RAW264.7 with an IC50 of 1.61μM. TH023 also inhibits the activation of NF-κB, reduces the nuclear translocation of NF-κB p65. TH023 exhibits anti-inflammatory efficacy in LPS (HY-D1056)-induced mouse acute sepsis model, and ameliorates the mouse lung injury .
|
-
- HY-66008S
-
|
N-Acetyl-5-aminosalicylic acid-d3; N-Acetyl-ASA-d3
|
Isotope-Labeled Compounds
Drug Metabolite
|
Inflammation/Immunology
Cancer
|
|
N-Acetyl mesalazine-d3 (N-Acetyl-5-aminosalicylic acid-d3) is the deuterium labeled N-Acetyl mesalazine (HY-66008). N-Acetyl mesalazine (N-Acetyl-5-aminosalicylic acid) is the primary intestinal metabolite of 5-Aminosalicylic Acid (HY-15027) and serves as a biomarker for evaluating the efficacy of 5-Aminosalicylic Acid (HY-15027). N-Acetyl mesalazine can scavenge free radicals, reduce DNA base hydroxylation, and ameliorate mucosal inflammation. N-Acetyl mesalazine can be used in the study of diseases such as colitis and colon cancer .
|
-
- HY-66008R
-
|
N-Acetyl-5-aminosalicylic acid (Standard); N-Acetyl-ASA (Standard)
|
Drug Metabolite
Reference Standards
|
Inflammation/Immunology
Cancer
|
|
N-Acetyl mesalazine (Standard) (N-Acetyl-5-aminosalicylic acid (Standard)) is the analytical standard of N-Acetyl mesalazine (HY-66008). This product is intended for research and analytical applications. N-Acetyl mesalazine (N-Acetyl-5-aminosalicylic acid) is the primary intestinal metabolite of 5-Aminosalicylic Acid (HY-15027) and serves as a biomarker for evaluating the efficacy of 5-Aminosalicylic Acid (HY-15027). N-Acetyl mesalazine can scavenge free radicals, reduce DNA base hydroxylation, and ameliorate mucosal inflammation. N-Acetyl mesalazine can be used in the study of diseases such as colitis and colon cancer .
|
-
- HY-N0755R
-
|
|
Reference Standards
Insulin Receptor
GLUT
NF-κB
p38 MAPK
Autophagy
|
Metabolic Disease
Endocrinology
Cancer
|
|
Rhoifolin (Standard) is the analytical standard of Rhoifolin. This product is intended for research and analytical applications. Rhoifolin is a flavone glycoside can be isolated from Rhus succedanea. Rhoifolin has anti-diabetic effect acting through enhanced adiponectin secretion, tyrosine phosphorylation of insulin receptor-β and glucose transporter 4 (GLUT 4) translocation. Rhoifolin has an anti-inflammatory action via multi-level regulation of inflammatory mediators. Rhoifolin ameliorates titanium particle-stimulated osteolysis and attenuates osteoclastogenesis via RANKL-induced NF-κB and MAPK pathways. Rhoifolin also has cytotoxic activity against different cancer cell lines .
|
-
- HY-14393R
-
|
Frangula emodin (Standard)
|
Reference Standards
SARS-CoV
Casein Kinase
Autophagy
11β-HSD
|
Cancer
|
|
Emodin (Standard) is the analytical standard of Emodin. This product is intended for research and analytical applications. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
|
-
- HY-155975
-
|
|
PI3K
|
Inflammation/Immunology
|
|
PI3Kδ-IN-14 (Compound (S)-29) is a selective PI3Kδ inhibitor (IC50: 0.8 nM, Kd: 84.8 nM). PI3Kδ-IN-14 binds to the ATP-binding site of the kinase domain of PI3Kδ. PI3Kδ-IN-14 has anti-inflammatory activity by inhibiting the PI3K/AKT pathway. PI3Kδ-IN-14 ameliorates acute lung injury (ALI) .
|
-
- HY-16561R
-
|
trans-Resveratrol (Standard); SRT501 (Standard)
|
Reference Standards
IKK
Autophagy
Mitophagy
Sirtuin
Apoptosis
Bacterial
Fungal
Antibiotic
Keap1-Nrf2
|
Infection
Inflammation/Immunology
Cancer
|
|
Resveratrol (Standard) is the analytical standard of Resveratrol. This product is intended for research and analytical applications. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
-
- HY-174400
-
|
|
SGLT
SOD
Na+/H+ Exchanger (NHE)
Autophagy
|
Cardiovascular Disease
|
|
SGLT2-IN-2 (Compound E9) is an inhibitor of SGLT2. SGLT2-IN-2 significantly enhances the inhibition of SGLT2, NHE1, and SOD enzyme activity. SGLT2-IN-2 has protective effect on the glucose-free DMEM-induced injured cardiomyocytes. SGLT2-IN-2 significantly improves cardiac function in TAC-induced HF mice and inhibits cardiomyocyte hypertrophy as well as collagen deposition. SGLT2-IN-2 can ameliorate myocardial tissue damage and enhance mitochondrial autophagy in injured cardiomyocytes, thereby increasing survival rates in HF mice .
|
-
- HY-W002942
-
|
1,2,3,4-Tetrahydroquinolin-8-ol; 8-hydroxy-1,2,3,4-tetrahydroquinoline
|
Ferroptosis
Reactive Oxygen Species (ROS)
|
Inflammation/Immunology
|
|
Ferroptosis-IN-21 is a ferroptosis inhibitor that protects against renal I/R injury by suppressing ferroptosis and directly scavenging peroxyl radicals. Ferroptosis-IN-21 displays broad-spectrum anti-ferroptotic efficacy across multiple inducers in renal tubular epithelial cells, with nanomolar potency and robust suppression of lipid Reactive Oxygen Species (ROS). Ferroptosis-IN-21 significantly ameliorates renal I/R injury in mice, reducing histological damage, functional impairment, and inflammatory cytokine expression, while decreasing lipid peroxidation biomarkers such as 4-hydroxynonenal. Ferroptosis-IN-12 can be used for research in the field of ferroptosis-targeted drug development .
|
-
- HY-16561S1
-
|
trans-Resveratrol-13C6; SRT501-13C6
|
Isotope-Labeled Compounds
IKK
Autophagy
Mitophagy
Sirtuin
Apoptosis
Bacterial
Fungal
Antibiotic
Keap1-Nrf2
|
Infection
Inflammation/Immunology
Cancer
|
|
Resveratrol- 13C6 is the 13C-labeled Resveratrol. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
-
- HY-16561S
-
|
trans-Resveratrol-d4; SRT501-d4
|
Isotope-Labeled Compounds
IKK
Autophagy
Mitophagy
Sirtuin
Apoptosis
Bacterial
Fungal
Antibiotic
Keap1-Nrf2
|
Infection
Inflammation/Immunology
Cancer
|
|
Resveratrol-d4 is the deuterium labeled Resveratrol. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
-
- HY-121246
-
|
AKF-PD
|
NF-κB
ERK
TGF-beta/Smad
|
Inflammation/Immunology
Cancer
|
|
Fluorofenidone (AKF-PD) is an orally active compound with anti-fibrotic, antioxidant, and anti-inflammatory pharmacological effects. Fluorofenidone downregulates the expression of ACSL4, upregulates GPX4 expression and inhibits the NF-κB signaling pathway to alleviate inflammation and fibrosis. Fluorofenidone ameliorates cholestasis and fibrosis by inhibiting hepatic Erk/-Egr-1 signaling and Tgfβ1/Smad pathway in mice. Fluorofenidone demonstrates protective effects against chronic lung injury in mice. Fluorofenidone can be used for the study of chronic obstructive pulmonary disease (COPD), pulmonary interstitial fibrosis (PIF) and non-small cell lung cancer (NSCLC) .
|
-
- HY-124832
-
|
|
Caspase
Amyloid-β
|
Neurological Disease
|
|
δ-Secretase inhibitor 11 (compound 11) is an orally active, potent, BBB-penetrated, non-toxic, selective and specific δ-secretase inhibitor, with an IC50 of 0.7 μM. δ-Secretase inhibitor 11 interacts with both the active site and allosteric site of δ-secretase. δ-Secretase inhibitor 11 attenuates tau and APP (amyloid precursor protein) cleavage. δ-Secretase inhibitor 11 ameliorates synaptic dysfunction and cognitive impairments in tau P301S and 5XFAD transgenic mouse models. δ-Secretase inhibitor 11 can be used for Alzheimer's disease research .
|
-
- HY-W017540
-
|
|
ATP Synthase
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Cancer
|
|
Cyclocreatine, a creatine analogue, acts as a brain-penetrant and potent bioenergetic protective agent by providing high levels of ATP. Cyclocreatine can be phosphorylated and dephosphorylated by creatine kinases. Cyclocreatine suppresses creatine metabolism ameliorating the cognitive, autistic and epileptic phenotype in a mouse model of creatine transporter defciency. Cyclocreatine protects against ischemic injury and enhances cardiac recovery during early reperfusion in dogs and rats. Cyclocreatine decreases plaque-adjacent neuronal dystrophy in TREM2-deficient mice with amyloid-β pathology. Cyclocreatine is proming for research of ischemic heart disease, cardiovascular diseases, Alzheimer’s disease and other neurodegenerative diseases associated with microglial dysfunction, prostate cancer .
|
-
- HY-114911R
-
|
DA2370 (Standard); Prenazone (Standard); Zepelin (Standard)
|
Reference Standards
COX
Reactive Oxygen Species (ROS)
MMP
|
Inflammation/Immunology
|
|
Feprazone (Standard) is the analytical standard of Feprazone. This product is intended for research and analytical applications. Feprazone (DA2370; Prenazone), an analogue of Phenylbutazone (HY-B0230), is a nonsteroidal anti-inflammatory agent with analgesic and antipyretic activities. Feprazone acts by inhibiting the activity of cyclooxygenase (COX)-2. Feprazone ameliorates free fatty acid (FFA)-induced oxidative stress by reducing the production of mitochondrial reactive oxygen species (ROS). Feprazone can decrease the expression of MMP-2 and MMP-9. Besides, Feprazone can suppress adipogenesis and increase lipolysis in differentiating 3 T3-L1 cells. Feprazone also can be used to research atherosclerosis and obesity .
|
-
- HY-17655
-
|
|
Reactive Oxygen Species (ROS)
|
Inflammation/Immunology
|
|
TBE56, a molecular glue, is a BACH1 degrader, with an EC50 of 44 nM. TBE56 is a weak NRF2 inducer and the biotinylated TBE31. TBE56 interacts and promotes the
degradation of BACH1 via a mechanism involving the E3 ligase FBX022. TBE56 reduces intracellular Fe 2+ accumulation, ROS generation, and malondialdehyde (MDA) content, while increasing GSH/GSSG ratio and upregulating GPX4 in Prominin-2-overexpressed BMSCs. TBE56 significantly ameliorates intervertebral disc degeneration (IVDD) in puncture-induced SD rat IVDD model. TBE56 can be used for the study of intervertebral disc degeneration (IVDD) .
|
-
- HY-176274
-
-
- HY-116673
-
|
|
Histone Acetyltransferase
|
Neurological Disease
|
|
TTK21 is an activator of the histone acetyltransferases CBP/p300. TTK21 passes the blood–brain barrier, induces no toxicity, and reaches different parts of the brain when conjugated to glucose-based carbon nanosphere (CSP). TTK21 has beneficial implications for the brain functions of neurogenesis and long-term memory .CSP-TTK21 can ameliorate Aβ-impaired long-term potentiation (LTP). CSP-TTK21 may enhance the transcription of genes that promote synaptic health and cognitive function . CSP-TTK21 is orally effective and leads to improvements in motor functions, histone acetylation dynamics in a spinal injury rat model .
|
-
- HY-114360
-
|
|
Endogenous Metabolite
COX
Interleukin Related
Glutathione Peroxidase
TNF Receptor
|
Metabolic Disease
Inflammation/Immunology
|
|
Taurohyodeoxycholic acid is an orally active 6 alpha-hydroxylated bile acid. Taurohyodeoxycholic acid decreases colonic MPO activity, TNF-α, lL-6 serum levels and the expression of COX-2. Taurohyodeoxycholic acid alleviates trinitrobenzene sulfonic acid induced ulcerative colitis via regulating Th1/Th2 and Th17/Treg cells balance. Taurohyodeoxycholic acid ameliorates high-fat diet-induced nonalcoholic fatty liver disease in mice. Taurohyodeoxycholic acid prevents Taurochenodeoxycholic acid (HY-N2027)-induced hepatotoxicity in bile fistula rats. Taurohyodeoxycholic acid can be used for the study of nonalcoholic fatty liver disease (NAFLD), colitis and biliary fistula .
|
-
- HY-N2995
-
|
Poricoic acid A(F)
|
NF-κB
Keap1-Nrf2
AMPK
TGF-beta/Smad
Reactive Oxygen Species (ROS)
|
Inflammation/Immunology
Cancer
|
|
Poricoic acid A can be isolated from Poria cocos. Poricoic acid A is an orally active anti-tumor agent. Poricoic acid A enhances melatonin inhibition of AKI-to-CKD transition by regulating Gas6/AxlNFκB/Nrf2 axis. Poricoic acid A also attenuatea fibroblast activation and abnormal extracellular matrix remodeling in renal fibrosis by activating AMPK and inhibiting Smad3. Poricoic acid A significantly reduces the magnitude of rise in serum creatinine and urea levels in rat model when combined with Melatonin. Poricoic acid A ameliorates renal fibrosis and podocyte injury by attenuating oxidative stress and inflammation through regulating NF-κB and Nrf2 in IRI rodent model in combination with Melatonin .
|
-
- HY-149010
-
|
|
Keap1-Nrf2
|
Neurological Disease
|
|
NXPZ-2 is an orally active Keap1-Nrf2 protein–protein interaction (PPI) inhibitor with a Ki value of 95 nM, EC50 value of 120 and 170 nM. NXPZ-2 can dose-dependently ameliorate Aβ[1-42]-Induced cognitive dysfunction, improve brain tissue pathological changes in Alzheimer’s disease (AD) mouse by increasing neuron quantity and function. NXPZ-2 can inhibit oxidative stress by increasing Nrf2 expression levels and promoting its cytoplasm to nuclear translocation, which is helpful for Keap1-Nrf2 PPI inhibitors and AD associated disease research .
|
-
- HY-W017540R
-
|
|
ATP Synthase
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Cancer
|
|
Cyclocreatine, a creatine analogue, acts as a brain-penetrant and potent bioenergetic protective agent by providing high levels of ATP. Cyclocreatine can be phosphorylated and dephosphorylated by creatine kinases. Cyclocreatine suppresses creatine metabolism ameliorating the cognitive, autistic and epileptic phenotype in a mouse model of creatine transporter defciency. Cyclocreatine protects against ischemic injury and enhances cardiac recovery during early reperfusion in dogs and rats. Cyclocreatine decreases plaque-adjacent neuronal dystrophy in TREM2-deficient mice with amyloid-β pathology. Cyclocreatine is proming for research of ischemic heart disease, cardiovascular diseases, Alzheimer’s disease and other neurodegenerative diseases associated with microglial dysfunction, prostate cancer .
|
-
- HY-175869
-
|
|
Ferroptosis
|
Metabolic Disease
Inflammation/Immunology
|
|
Ferroptosis-IN-22 is a selective ferroptosis inhibitor by targeting NCOA4 and disrupting its interaction with ferritin with an EC50 of 520 nM and a Kd of 0.78 μM. Ferroptosis-IN-22 has a strong inhibitory activity against ferroptosis induced by multiple ferroptosis inducers (RSL3 (HY-100218A), Erastin (HY-15763), ML210 (HY-100003), FIN56 (HY-103087)), but does not inhibit necrosis induced by H2O2 or apoptosis induced by STS (HY-15141). Ferroptosis-IN-22 effectively ameliorates Concanavalin A (HY-P2149)-induced acute liver injury. Ferroptosis-IN-22 can be used for the study of ferroptosis-related diseases .
|
-
- HY-178169
-
|
|
Toll-like Receptor (TLR)
p38 MAPK
TNF Receptor
ERK
JNK
NF-κB
Interleukin Related
|
Inflammation/Immunology
|
|
ETI60 is an orally active, selective TLR inhibitor that targets the nucleoside-binding Site I on TLR7 (IC50 = 0.68 μM) and TLR9 (IC50 = 0.12 μM), sparing surface TLRs (including TLR1/TLR2, TLR2/TLR6, TLR4 and TLR5). ETI60 potently inhibits endosomal TLR-mediated pro-inflammatory signaling with nanomolar activity in cellular, biophysical and in vivo assays. ETI60 modulates the expression of genes associated with inflammation. ETI60 effectively ameliorates symptoms in mouse models of psoriasis, and systemic lupus erythematosus (SLE). ETI60 can be used for autoimmune and inflammatory diseases research .
|
-
- HY-N2492
-
|
Methyl trans-p-coumarate
|
Apoptosis
Interleukin Related
GSK-3
Parasite
|
Infection
Cancer
|
|
(E)-Methyl 4-coumarate (Methyl 4-hydroxycinnamate) is a phenolic compound and derivative of Cinnamic acid (HY-N0610A). (E)-Methyl 4-coumarate can be found in several plants, such as the leaves of Allium cepa and Morinda citrifolia L. (E)-Methyl 4-coumarate, when combined with Carnosic acid (HY-N0644), induces Apoptosis. (E)-Methyl 4-coumarate inhibits GSK3β activity and modulates inflammatory cytokine levels (increasing IL-10 and decreasing IL-4). (E)-Methyl 4-coumarate combined with Carnosic acid exhibits anticancer effects against acute myeloid leukemia. (E)-Methyl 4-coumarate ameliorates Plasmodium berghei NK65 infection .
|
-
- HY-178166
-
|
|
Toll-like Receptor (TLR)
p38 MAPK
TNF Receptor
ERK
JNK
NF-κB
Interleukin Related
|
Inflammation/Immunology
|
|
ETI41 is an orally active, selective TLR inhibitor that targets the nucleoside-binding Site I on TLR7 (IC50 = 0.63 μM) and TLR9 (IC50 = 0.16 μM), sparing surface TLRs (including TLR1/TLR2, TLR2/TLR6, TLR4 and TLR5). ETI41 potently inhibits endosomal TLR-mediated pro-inflammatory signaling with nanomolar activity in cellular, biophysical and in vivo assays. ETI41 suppresses the expression of inflammation-associated genes and effectively ameliorates symptoms in mouse models of psoriasis, and systemic lupus erythematosus (SLE). ETI41 can be used for autoimmune and inflammatory diseases research .
|
-
- HY-121246R
-
|
|
Reference Standards
NF-κB
ERK
TGF-beta/Smad
|
Inflammation/Immunology
|
|
Fluorofenidone (Standard) is the analytical standard of Fluorofenidone (AKF-PD) (HY-121246). This product is intended for research and analytical applications. Fluorofenidone is an orally active compound with anti-fibrotic, antioxidant, and anti-inflammatory pharmacological effects. Fluorofenidone downregulates the expression of ACSL4, upregulates GPX4 expression and inhibits the NF-κB signaling pathway to alleviate inflammation and fibrosis. Fluorofenidone ameliorates cholestasis and fibrosis by inhibiting hepatic Erk/-Egr-1 signaling and Tgfβ1/Smad pathway in mice. Fluorofenidone demonstrates protective effects against chronic lung injury in mice. Fluorofenidone can be used for the study of chronic obstructive pulmonary disease (COPD), pulmonary interstitial fibrosis (PIF) and non-small cell lung cancer (NSCLC) .
|
-
- HY-P5381
-
-
- HY-168729
-
|
|
Bacterial
|
Infection
|
|
Antibacterial agent 256 (Compound C09) is an inhibitor for type I signal peptidase (SPase I). Antibacterial agent 256 inhibits gram-positive bacteria, that inhibits S. aureus ATCC 29213, E. faecium QF31, E. faecalis SF23-1 and S. suis P1/7, with MIC of 1-16 μg/mL. Antibacterial agent 256 exhibits cytotoxicity in cancer cell HEp-2 and Caco-2 with CC50 of 14.65 μg/mL and 21.93 μg/mL. Antibacterial agent 256 exhibits a hemolytic activity on mouse RBCs, with an HC50 of 13.29 μg/mL. Antibacterial agent 256 ameliorates the MRSA skin infection in mouse model .
|
-
- HY-163897
-
|
|
PROTACs
Ferroptosis
Reactive Oxygen Species (ROS)
|
Inflammation/Immunology
|
|
PROTAC NCOA4 degrader-1 is a VHL-based PROTAC NCOA4 degrader. PROTAC NCOA4 degrader-1 is a ferroptosis inhibitor. PROTAC NCOA4 degrader-1 reduces Fe 2+ elevation, ROS production, MDA content and PTGS2 mRNA expression. PROTAC NCOA4 degrader-1 ameliorates liver damage in a CCl4-induced acute liver injury model. PROTAC NCOA4 degrader-1 can be used for the researches of inflammation and immunology. (Pink: NCOA4 ligand (HY-149457). Black: linker (HY-163903). Blue: VHL ligand (HY-138678B)) .
|
-
- HY-178761
-
|
|
Phosphoglycerate Kinase (PGK)
|
Inflammation/Immunology
|
|
PGK1-IN-1 (Compound 6e) is a potent and selective PGK1 inhibitor (IC50: 33 nM). PGK1-IN-1 inhibits PGK1-mediated glycolytic metabolism and reduces glucose consumption/lactate production. PGK1-IN-1 enhances Nrf2 accumulation and HO-1 expression, and suppresses the transcription and protein levels of the inflammatory cytokines IL-1β and IL-6. PGK1-IN-1 ameliorates Dextran sulfate sodium (DSS) (HY-116282C)-induced experimental colitis in mice. PGK1-IN-1 can be used for research of inflammatory bowel disease (IBD) .
|
-
- HY-159834
-
|
SLC-D011
|
DNA/RNA Synthesis
|
Others
|
|
Progerinin (SLC-D011) is an orally active progerin-lamin A binding inhibitor. Progerinin selectively binds to the C-terminal region of progerin, disrupting its interaction with lamin A and promoting progerin degradation while sparing wild-type lamin A, B, and C. Progerinin ameliorates nuclear deformation, increases H3K9me3 levels, and reduces progerin expression in HGPS patient-derived fibroblasts. Progerinin extends lifespan in Lmna G609G/G609G mice and Lmna G609G/+ mice, improves body weight, hair morphology, cardiac function, and histological phenotypes. Progerinin can be used for the study of Hutchinson-Gilford progeria syndrome (HGPS) .
|
-
- HY-172883A
-
|
|
FABP
PPAR
|
Metabolic Disease
Inflammation/Immunology
|
|
(E/Z)-ABP/PPAR modulator 1 is a mixture of the E and Z isomers of ABP/PPAR modulator 1 (HY-172883). ABP/PPAR modulator 1 is an orally active FABP and PPAR multiple modulator (IC50s of 0.65 μM and 1.08 μM for FABP1 and FABP4, EC50 s of 9.19 μM, 2.20 μM and 1.58 μM for PPARα, PPARγ and PPARδ). ABP/PPAR modulator 1 has potent anti-metabolic dysfunction-associated steatohepatitis (MASH) activity. ABP/PPAR modulator 1 dose-dependently ameliorates multiple pathological characteristics of fatty liver in WD + Carbon tetrachloride-induced MASH mice model .
|
-
- HY-16561G
-
|
trans-Resveratrol; SRT501
|
IKK
Autophagy
Mitophagy
Sirtuin
Apoptosis
Bacterial
Fungal
Keap1-Nrf2
|
Infection
Inflammation/Immunology
Cancer
|
|
Resveratrol (GMP) is Resveratrol (HY-16561) produced by using GMP guidelines. GMP small molecules work appropriately as an auxiliary reagent for cell therapy manufacture. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
-
- HY-N3021R
-
|
|
Endogenous Metabolite
NF-κB
TNF Receptor
FOXO
Microtubule/Tubulin
|
Metabolic Disease
|
|
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .
|
-
- HY-121246S
-
|
AKF-PD-d3
|
Isotope-Labeled Compounds
NF-κB
ERK
TGF-beta/Smad
|
Inflammation/Immunology
Cancer
|
|
Fluorofenidone-d3 (AKF-PD-d3) is deuterium labeled Fluorofenidone (AKF-PD) (HY-121246). Fluorofenidone is an orally active compound with anti-fibrotic, antioxidant, and anti-inflammatory pharmacological effects. Fluorofenidone downregulates the expression of ACSL4, upregulates GPX4 expression and inhibits the NF-κB signaling pathway to alleviate inflammation and fibrosis. Fluorofenidone ameliorates cholestasis and fibrosis by inhibiting hepatic Erk/-Egr-1 signaling and Tgfβ1/Smad pathway in mice. Fluorofenidone demonstrates protective effects against chronic lung injury in mice. Fluorofenidone can be used for the study of chronic obstructive pulmonary disease (COPD), pulmonary interstitial fibrosis (PIF) and non-small cell lung cancer (NSCLC) .
|
-
- HY-W017540S
-
|
|
Isotope-Labeled Compounds
ATP Synthase
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Cancer
|
|
Cyclocreatine- 13C3 is the 13C-labeled Cyclocreatine (HY-W017540). Cyclocreatine, a creatine analogue, acts as a brain-penetrant and potent bioenergetic protective agent by providing high levels of ATP. Cyclocreatine can be phosphorylated and dephosphorylated by creatine kinases. Cyclocreatine suppresses creatine metabolism ameliorating the cognitive, autistic and epileptic phenotype in a mouse model of creatine transporter defciency. Cyclocreatine protects against ischemic injury and enhances cardiac recovery during early reperfusion in dogs and rats. Cyclocreatine decreases plaque-adjacent neuronal dystrophy in TREM2-deficient mice with amyloid-β pathology. Cyclocreatine is proming for research of ischemic heart disease, cardiovascular diseases, Alzheimer’s disease and other neurodegenerative diseases associated with microglial dysfunction, prostate cancer .
|
-
- HY-158978
-
|
|
Cholinesterase (ChE)
Monoamine Oxidase
|
Neurological Disease
|
|
Multitarget AD inhibitor-2 (Compound VN-19) is a multitargeting inhibitor acetylcholinesterase (AChE, IC50=0.14 μM), butyrylcholinesterase (BChE, IC50=11.6 μM), monoamine oxidase B (MAO B, IC50=0.45 μM). Multitarget AD inhibitor-2 inhibits self-induced aggregation of amyloid beta protein Aβ1-42 (inhibition rate is 47.3% at 20 μM), and downregulates the level of ROS in SH-SY5Y (80 inhibition rate at 25 μM). Multitarget AD inhibitor-2 ameliorates the cognitive decline in Scopolamine (HY-N0296)-induced Alzheimer’s Disease zebrafish models .
|
-
- HY-N3021
-
|
|
Endogenous Metabolite
NF-κB
TNF Receptor
FOXO
Microtubule/Tubulin
|
Metabolic Disease
|
|
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .
|
-
- HY-N1916
-
|
|
Glutathione S-transferase
P-glycoprotein
Apoptosis
iGluR
CaMK
p38 MAPK
Reactive Oxygen Species (ROS)
Bacterial
|
Infection
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
Cancer
|
|
Coniferyl ferulate is an orally active phenolic acid compound. Coniferyl ferulate is a potent inhibitor of glutathione S-transferase (GST) (IC50 = 0.3 μM), which downregulates P-gp expression, induces apoptosis in B-MD-C1 (ADR+/+) cells, and reverses multidrug resistance. Coniferyl ferulate blocks the NMDAR/NR2B-CaMKII-MAPKs signaling pathway, inhibits ROS production and mitochondrial apoptosis, while reshapes the intestinal microbiota and microbial metabolism, ameliorates colonic inflammation and alleviates depressive symptoms in mice. Coniferyl ferulate can alleviate the toxicity of xylene to hematopoietic stem and progenitor cells by targeting Mgst2. Coniferyl ferulate exhibits antibacterial activity against the Gram-positive Bacillus subtilis and Staphylococcus aureus .
|
-
- HY-161708
-
|
|
PROTACs
CDK
FLT3
|
Cancer
|
|
PROTAC FLT3/CDKs degrader-1 (Compound C3) is a degrader for cyclin-dependent kinases (DC50 is 18.73 nM for CDK2) and the FMS-like tyrosine kinase 3 (FLT3). PROTAC FLT3/CDKs degrader-1 induces differentation of HL-60 (72.77% differentation at 6.25 nM), inhibits proliferation of AML cells, with IC50s of 2.9-37 nM. PROTAC FLT3/CDKs degrader-1 is potential for ameliorating acute myeloid leukemia. (Pink: ligand for target protein FLT3/CDKs ligand-1 (HY-161709); Black: linker (HY-W012935); Black: ligand for E3 ligase Thalidomide 5-fluoride (HY-W087383))
|
-
- HY-178356
-
|
|
Cholinesterase (ChE)
nAChR
Interleukin Related
TNF Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
BChE-IN-44 is a potent, brain-penetrant, highly selective BChE inhibitor [equine BChE IC50 = 18.00 pM, human BChE IC50 = 1.50 nM]. BChE-IN-44 shows neuroprotective effects against the Aβ1-42-induced injury model and inhibitory effects on Aβ1-42 self-aggregation. BChE-IN-44 reduces the levels of inflammatory factors (NO, IL-6, and TNF-α) in Lipopolysaccharides (HY-D1056)-induced BV2 cells. BChE-IN-44 can significantly ameliorate Scopolamine (HY-N0296)-induced cognition impairment. BChE-IN-44 exhibits capacity in the regulation of BChE and acetylcholine levels in the mouse hippocampus. BChE-IN-44 can be used for the study of Alzheimer’s disease (AD) .
|
-
- HY-161449
-
|
|
11β-HSD
|
Metabolic Disease
|
|
JTT-654 is an orally active, potent and selective11β-Hydroxysteroid dehydrogenase type 1 (11β-HSD1) inhibitor. The IC50 of JTT-654 for 11β-HSD1 is 4.65, 0.97, and 0.74 nM in human, rat, and mouse recombinant enzymes, respectively. JTT-654 showed competitive inhibition against human recombinant enzyme. The IC50 value for human 11β-HSD2 is > 30 μM (human 11β-HSD2 is responsible for the reverse reaction against human 11β-HSD1). JTT-654 ameliorates insulin resistance and non-obese type 2 diabetes by inhibiting adipose tissue and liver 11β-HSD1 .
|
-
- HY-N2492R
-
|
Methyl trans-p-coumarate (Standard)
|
Reference Standards
Apoptosis
Parasite
Interleukin Related
GSK-3
|
Infection
Cancer
|
|
(E)-Methyl 4-coumarate (Standard) is the analytical standard of (E)-Methyl 4-coumarate (HY-N2492). This product is intended for research and analytical applications. (E)-Methyl 4-coumarate (Methyl 4-hydroxycinnamate) is a phenolic compound and derivative of Cinnamic acid (HY-N0610A). (E)-Methyl 4-coumarate can be found in several plants, such as the leaves of Allium cepa and Morinda citrifolia L. (E)-Methyl 4-coumarate, when combined with Carnosic acid (HY-N0644), induces Apoptosis. (E)-Methyl 4-coumarate inhibits GSK3β activity and modulates inflammatory cytokine levels (increasing IL-10 and decreasing IL-4). (E)-Methyl 4-coumarate combined with Carnosic acid exhibits anticancer effects against acute myeloid leukemia. (E)-Methyl 4-coumarate ameliorates Plasmodium berghei NK65 infection .
|
-
- HY-174829
-
|
|
Protease Activated Receptor (PAR)
NF-κB
Reactive Oxygen Species (ROS)
Calcium Channel
Akt
ERK
p38 MAPK
PKC
|
Cardiovascular Disease
Metabolic Disease
|
|
7,4'-Dimethoxy-3-hydroxyflavone is an orally active PAR4 antagonist. 7,4'-Dimethoxy-3-hydroxyflavone inhibits PAR4-mediated human platelet aggregation with an IC50 of 1.4 μM. 7,4'-Dimethoxy-3-hydroxyflavone inhibits PAR4-mediated human platelet aggregation and PAR4 signaling pathways, including NF-κB, Ca 2+/protein kinase C, Akt, ERK and p38. 7,4'-Dimethoxy-3-hydroxyflavone prevents vascular PAR4 expression, endothelial dysfunction and ameliorates oxidative stress in Streptozotocin (STZ) (HY-13753)-induced diabetic mice.
7,4'-Dimethoxy-3-hydroxyflavone prevents thrombosis in mice without affecting bleeding time [1][2].
|
-
- HY-N2255
-
|
|
Akt
Apoptosis
NF-κB
Reactive Oxygen Species (ROS)
p38 MAPK
ERK
Interleukin Related
TNF Receptor
NO Synthase
nAChR
Bacterial
|
Infection
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
Cancer
|
|
Crebanine is an isoquinoline-like alkaloid that can be derived from Stephania. Crebanine is an antagonist of the α7-nAChR with an IC50 of 19.1 μM. Crebanine suppresses the proliferation, migration, and invasion of cancer cells, triggers reactive oxygen species (ROS) burst, and promotes apoptosis. Crebanine inhibits the AKT/FoxO3a, NF-κB and MAPK signaling pathways. Crebanine attenuates NOX2 hyperactivation, exhibits antioxidant properties by reducing reactive oxygen species and peroxidation. Crebanine inhibits voltage-dependent Na + current in guinea-pig ventricular myocytes. Crebanine has high inhibitory activity against gram-positive animal pathogenic bacteria. Crebanine ameliorates ischemia-reperfusion brain damage in middle cerebral artery occlusion and reperfusion (MCAO/R) rats. Crebanine significantly improves Scopolamine (HY-N0296)-induced cognitive deficits in ICR mice. Crebanine can be used for the study of hepatocellular carcinoma (HCC), cerebral ischemia and Alzheimer's disease .
|
-
- HY-175862
-
|
|
Aldose Reductase
Reactive Oxygen Species (ROS)
PI3K
Akt
SOD
p38 MAPK
Keap1-Nrf2
|
Metabolic Disease
|
|
ALR2-IN-9 is a potent ALR2 inhibitor (IC50 = 21.8 nM) with excellent antioxidant activity (EC50 for DPPH radical scavenging = 2.8 μM). ALR2-IN-9 interacts directly with Reactive Oxygen Species (ROS)/Reactive Nitrogen Species (RNS) and interrupts the free radical chain reactions, and as an endogenous enzymatic antioxidant regulator, which regulates enzyme functions of CAT and SOD. ALR2-IN-9 regulates PI3K/Akt/Nrf2 pathway to attenuate hyperglycemia-mediated mitochondrial superoxide overproduction in vitro, and ameliorates CuSO4- and H2O2-induced oxidative stress in vivo. ALR2-IN-9 prolongs lifespan of C. elegans via the regulation of stress response genes such as PMK-1. ALR2-IN-9 is a promising anti-aging drug candidate. ALR2-IN-9 can be used for diabetic complication research .
|
-
- HY-N6871
-
|
|
Bacterial
IKK
Ferroptosis
|
Infection
Metabolic Disease
Inflammation/Immunology
Cancer
|
Abietic acid, an orally active diterpene isolated from Colophony, displays significant anti-proliferative, anti-inflammatory, anti-obesity effect, bacteriostatic, cell cycle arresting and pro-apoptotic activities. Abietic acid inhibits lipoxygenase activity for allergy. Abietic acid enhances cell migration and tube formation in HUVECs. Abietic acid induces significant angiogenic potential, which is associated with upregulation of extracellular signal-regulated kinase (ERK) and p38 expression. Abietic acid attenuates sepsis-induced lung injury by inhibiting nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) pathway to inhibit M1 macrophage polarization. Abietic acid exhibits a positive effect against liver injury by attenuating inflammation and ferroptosis. Abietic acid shows accelerated wound closure in a mouse model of cutaneous wounds. Abietic acid significantly reduces the proliferation and growth of NSCLC cells by IKKβ inhibition.Additionally, Abietic acid ameliorates psoriasis-like inflammation and modulates gut microbiota in mice. Abietic acid is promising for research in non-small-cell lung cancer (NSCLC), liver injury-related deseases and psoriasis .
|
-
- HY-N0469R
-
|
|
Reference Standards
Endogenous Metabolite
Virus Protease
HSV
|
Infection
Metabolic Disease
Inflammation/Immunology
|
L-Lysine (Standard) is the analytical standard of L-Lysine. This product is intended for research and analytical applications. L-lysine is an essential amino acid for humans with orally activity. L-lysine can inhibit the occurrence of HSV infections and is used in herpes research. L-lysine increases calcium absorption, reduces diabetes-related diseases, improves gut health, and alleviates pancreatic inflammation. L-lysine can be used in research on metabolism, infection, and inflammation .
IC50 & Target:L-lysine (150 mg/kg) promotes, but not initiates, bladder cancer. The administration of L-lysine to rats submitted to colovesical cystoplasty accelerates the development of transitional metaplasia of the intestinal epithelium .
L-lysine (10 mg/kg) treatment attenuates pancreatic tissue injury induced by L-arginine by inhibiting the release of the inflammatory cytokine IL-6 and enhance antioxidant activity .
In Vivo:L-lysine (10?mg/kg, p.o., pre-treated or post-treated, administration duration 15 days) treatment attenuates pancreatic tissue injury induced by L-arginine by inhibiting the release of the inflammatory cytokine IL-6 and enhance antioxidant activity in acute pancreatitis mice model .
L-lysine (5 or 10?mg/kg, p.o., 45 days) ameliorates sepsis-induced acute lung injury in a lipopolysaccharide (HY-D1056)-induced mouse model .
|
-
- HY-162812
-
|
|
Apoptosis
Cholinesterase (ChE)
Tau Protein
Ferroptosis
Histamine Receptor
|
Neurological Disease
|
|
H3R antagonist 4 (compound 11L) was a dual inhibitor of cholinesterase and histamine receptor (H3R), with corresponding IC50 of 7.04 μM (eeAChE), 9.73 μM (hAChE)(reversible) and 1.09 nM (H3R) , respectively. H3R antagonist 4 inhibited the aggregation of Aβ1-42 induced by itself and Cu 2+ (95.48% and 88.63%) , and degraded the Aβ1-42 fibrils induced by itself and Cu 2+ (80.16% and 89.30%) . H3R antagonist 4 chelate biometals such as Cu 2+, Zn 2+, Al 3+, and Fe 2+. H3R antagonist 4 significantly reduced tau protein hyperphosphorylation induced by Aβ1-42 and inhibited RSL-3-induced apoptosis and ferroptosis in PC12 cells. H3R antagonist 4 had the best blood-brain barrier permeability and intestinal absorption in hCMEC/D3 and hPepT1-MDCK cells.H3R antagonist 4 ameliorates learning and memory impairment in a mouse model of Alzheimer's disease induced by scopolamine (HY-N0296) .
|
-
| Cat. No. |
Product Name |
Type |
-
- HY-U00449G
-
|
|
Fluorescent Dye
|
|
AGN 193109 (GMP) is AGN 193109 (HY-U00449) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. AGN 193109 is a specific and highly effective retinoic acid receptor (RAR) antagonist . AGN 193109 (GMP) is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. AGN 193109 is the antidote for retinoic acidosis, that ameliorates the skin and mucosal toxicity.
|
-
- HY-B0377G
-
|
MK-208 (GMP)
|
Fluorescent Dye
|
|
Famotidine GMP (MK-208 GMP) is Famotidine (HY-B0377) produced in GMP guideline. Famotidine GMP is a competitive histamine H2-receptor antagonist, inhibits gastric secretion, activates the gastric mucosal defensive mechanisms. Famotidine GMP ameliorates peptic ulcer disease (PUD) and gastroesophageal reflux disease (GERD/GORD) in rats model .
|
-
- HY-B0399G
-
|
(R)-Carnitine (GMP); Levocarnitine (GMP)
|
Fluorescent Dye
|
|
L-Carnitine (GMP) is L-Carnitine (HY-B0399) produced by using GMP guidelines. GMP small molecules work appropriately as an auxiliary reagent for cell therapy manufacture. L-Carnitine, a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine is an antioxidant. L-Carnitine can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-16561G
-
|
trans-Resveratrol (GMP); SRT501 (GMP)
|
Fluorescent Dye
|
|
Resveratrol (GMP) is Resveratrol (HY-16561) produced by using GMP guidelines. GMP small molecules work appropriately as an auxiliary reagent for cell therapy manufacture. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
| Cat. No. |
Product Name |
Type |
-
- HY-W105518
-
|
|
Biochemical Assay Reagents
|
|
L-Carnitine tartrate is a highly polar, small zwitterion. L-Carnitine tartrate is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine tartrate functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine tartrate is an antioxidant. L-Carnitine tartrate can ameliorate metabolic imbalances in many inborn errors of metabolism [3] .
|
-
- HY-W011012
-
|
|
Enzyme Substrates
|
|
Adenosine 5'-monophosphate disodium is an orally active purine nucleotide, and participates in ATP metabolism. Adenosine 5'-monophosphate disodium is also a ligand for adenosine 2B receptor. Adenosine 5'-monophosphate disodium can activate AMPK in skeletal muscle, and ameliorates insulin resistance and impaired glucose metabolism. Adenosine 5'-monophosphate disodium can be used for research of diabetes .
|
-
- HY-U00449G
-
|
|
Biochemical Assay Reagents
|
|
AGN 193109 (GMP) is AGN 193109 (HY-U00449) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. AGN 193109 is a specific and highly effective retinoic acid receptor (RAR) antagonist . AGN 193109 (GMP) is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. AGN 193109 is the antidote for retinoic acidosis, that ameliorates the skin and mucosal toxicity.
|
-
- HY-B0377G
-
|
MK-208 (GMP)
|
Biochemical Assay Reagents
|
|
Famotidine GMP (MK-208 GMP) is Famotidine (HY-B0377) produced in GMP guideline. Famotidine GMP is a competitive histamine H2-receptor antagonist, inhibits gastric secretion, activates the gastric mucosal defensive mechanisms. Famotidine GMP ameliorates peptic ulcer disease (PUD) and gastroesophageal reflux disease (GERD/GORD) in rats model .
|
-
- HY-B0399G
-
|
(R)-Carnitine (GMP); Levocarnitine (GMP)
|
Biochemical Assay Reagents
|
|
L-Carnitine (GMP) is L-Carnitine (HY-B0399) produced by using GMP guidelines. GMP small molecules work appropriately as an auxiliary reagent for cell therapy manufacture. L-Carnitine, a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine is an antioxidant. L-Carnitine can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-W105518R
-
|
|
Biochemical Assay Reagents
|
|
L-Carnitine (tartrate) (Standard) is the analytical standard of L-Carnitine (tartrate). This product is intended for research and analytical applications. L-Carnitine tartrate is a highly polar, small zwitterion. L-Carnitine tartrate is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine tartrate functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine tartrate is an antioxidant. L-Carnitine tartrate can ameliorate metabolic imbalances in many inborn errors of metabolism [3] .
|
-
- HY-W011012R
-
|
|
Enzyme Substrates
|
|
Adenosine 5'-monophosphate (disodium) (Standard) is the analytical standard of Adenosine 5'-monophosphate (disodium). This product is intended for research and analytical applications. Adenosine 5'-monophosphate disodium is an orally active purine nucleotide, and participates in ATP metabolism. Adenosine 5'-monophosphate disodium is also a ligand for adenosine 2B receptor. Adenosine 5'-monophosphate disodium can activate AMPK in skeletal muscle, and ameliorates insulin resistance and impaired glucose metabolism. Adenosine 5'-monophosphate disodium can be used for research of diabetes .
|
-
- HY-16561G
-
|
trans-Resveratrol (GMP); SRT501 (GMP)
|
Biochemical Assay Reagents
|
|
Resveratrol (GMP) is Resveratrol (HY-16561) produced by using GMP guidelines. GMP small molecules work appropriately as an auxiliary reagent for cell therapy manufacture. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
| Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P10269
-
|
GZR18
|
GLP Receptor
|
Metabolic Disease
|
|
Bofanglutide (GZR18) is an analog of glucagon-like peptide-1 (GLP-1), which exhibits agonistic activity for GLP-1 receptor, with an EC50 of 0.677 nM. GZR18 ameliorates type 2 diabetes .
|
-
- HY-106262B
-
|
KAI-9803 hydrochloride; BMS-875944 hydrochloride
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
-
- HY-P10272
-
|
PTG-300
|
Ferroportin
|
Others
|
|
Rusfertide is a peptide mimetic of natural hepcidin, which targets and degrades ferroportin, reduces serum iron and transferrin-saturation, and thus regulates the production of red blood cells. Rusfertide ameliorates the polycythemia vera, β-thalassemia and hereditary hemochromatosis .
|
-
- HY-P1173
-
|
Myristoylated L 803; GSK-3β Inhibitor XIII
|
GSK-3
Amyloid-β
|
Neurological Disease
|
|
L803-mts (Myristoylated L 803) is a selective and substrate-competitive GSK-3 peptide inhibitor (IC50: 40 μM). L803-mts also reduces Aβ deposits and ameliorates cognitive deficits in 5XFAD mice. L803-mts shows antidepressive effect in the forced swimming test .
|
-
- HY-P4191A
-
|
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P1098
-
Ac2-26
Maximum Cited Publications
7 Publications Verification
|
Annexin A
NF-κB
|
Inflammation/Immunology
|
|
Ac2-26 is the N-terminal peptide of annexin 1, and has anti-inflammatory activity. Ac2-26 induces a decrease in IKKβ protein in lysosomes by chaperone-mediated autophagy (CMA). Ac2-26 ameliorates lung ischemia-reperfusion injury. Ac2-26 also inhibits airway inflammation and hyperresponsiveness in an asthma rat model .
|
-
- HY-P1098A
-
Ac2-26 TFA
Maximum Cited Publications
7 Publications Verification
|
Annexin A
NF-κB
|
Inflammation/Immunology
|
|
Ac2-26 TFA is the N-terminal peptide of annexin 1, and has anti-inflammatory activity. Ac2-26 induces a decrease in IKKβ protein in lysosomes by chaperone-mediated autophagy (CMA). Ac2-26 ameliorates lung ischemia-reperfusion injury. Ac2-26 also inhibits airway inflammation and hyperresponsiveness in an asthma rat model .
|
-
- HY-106262
-
|
KAI-9803; BMS-875944
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Delcasertib (KAI-9803) is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
-
- HY-P11046
-
|
|
Interleukin Related
|
Inflammation/Immunology
|
|
IIIM1 is an orally active anti-inflammatory peptide. IIIM1 ameliorates the symptoms of experimental autoimmune encephalomyelitis (EAE) by stimulating the proliferation of regulatory T cells and inducing them to produce RA1, and regulating the cytokine balance. IIIM1 can be used in the research of multiple sclerosis (MS) .
|
-
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-105174
-
|
|
JAK
FAK
|
Inflammation/Immunology
|
|
BPC 157 is the 15-amino acide fragment of gastric peptide BPC. BPC 157 exhibits wound healing promoting and neuroprotective activity. BPC 157 maintains the integrity of the gastrointestinal mucosa without significant toxicity. BPC 157 acetate counteracts NSAIDs/insulin overdose/copper-induced toxicity. BPC 157 ameliorates specific (over)stimulated/damaged neurotransmitter systems-induced behavioral disorders through serotonergic and dopaminergic systems .
|
-
- HY-P1847
-
|
|
NF-κB
|
Cancer
|
|
IKKγ NBD Inhibitory Peptide is a highly specific inhibitor NF-κB inhibitor. IKKγ NBD Inhibitory Peptide acts by disrupting the interaction between IKKγ/NEMO-binding domain (NBD) with IKKα and IKKβ, thus blocking TNF-α-induced NF-kB activation. IKKγ NBD Inhibitory Peptide could significantly suppresses inflammation and ameliorate the cerebral ischemia-induced neurological deficits .
|
-
- HY-P5333A
-
|
UB311 immunogen I acetate
|
Amyloid-β
|
Neurological Disease
|
|
Aβ1-14-εK-KKK-MvF5 Th acetate is the acetate salt form of Aβ1-14-εK-KKK-MvF5 Th (HY-P5333). Aβ1-14-εK-KKK-MvF5 Th acetate is part of UB-311 vaccine, that targets the amyloid-beta (Aβ) protein, and ameliorates the Alzheimer’s disease .
|
-
- HY-P1098B
-
|
|
IKK
|
Inflammation/Immunology
|
|
Ac2-26 ammonium is the N-terminal peptide of annexin 1, and has anti-inflammatory activity. Ac2-26 ammonium induces a decrease in IKKβ protein in lysosomes by chaperone-mediated autophagy (CMA). Ac2-26 ammonium ameliorates lung ischemia-reperfusion injury. Ac2-26 ammonium also inhibits airway inflammation and hyperresponsiveness in an asthma rat model .
|
-
- HY-P5875
-
|
|
Protease Activated Receptor (PAR)
|
Cardiovascular Disease
Inflammation/Immunology
|
|
P4pal10 is an antagonist for protease-activated receptor 4 (PAR4). P4pal10 inhibits the platelet aggregation, inhibits tissue factor (TF)-induced thrombin generation, and exhibits anticoagulant and antithrombotic activities. P4pal10 reduces the oedema and the granulocyte infiltration induced by Carrageenan (HY-125474). P4pal10 ameliorates the injury in mice myocardial ischemia/reperfusion (I/R) models .
|
-
- HY-P1409
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-P1409A
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
ADWX 1 TFA is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 TFA ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 TFA can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-105174A
-
|
|
JAK
FAK
|
Neurological Disease
Metabolic Disease
|
|
BPC 157 acetate is the acetate salt form of BPC 157 (HY-105174). BPC 157 acetate is the 15-amino acide fragment of gastric peptide BPC. BPC 157 acetate exhibits wound healing promoting and neuroprotective activity. BPC 157 acetate maintains the integrity of the gastrointestinal mucosa without significant toxicity. BPC 157 acetate counteracts NSAIDs/insulin overdose/copper-induced toxicity. BPC 157 acetate ameliorates specific (over)stimulated/damaged neurotransmitter systems-induced behavioral disorders through serotonergic and dopaminergic systems .
|
-
- HY-P10580
-
|
|
Tie
|
Infection
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
Vasculotide, an angiopoietin-1 mimetic, is a Tie-2 activator and induces Tie-2 phosphorylation. Vasculotide has anti-inflammatiory effect and anti-permeability. Vasculotide ameliorates endotoxin-induced endothelial barrier dysfunction. Vasculotide promotes angiogenesis in a mouse model of diabetic ulcer. Vasculotide protects mice from vascular leakage and reduces mortality in murine abdominal sepsis. Vasculotide decreases microvascular leakage and improves microcirculatory perfusion in a rat model of hemorrhagic shock .
|
-
- HY-P1847A
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
IKKγ NBD Inhibitory Peptide TFA is a highly specific inhibitor NF-κB inhibitor. IKKγ NBD Inhibitory Peptide TFA acts by disrupting the interaction between IKKγ/NEMO-binding domain (NBD) with IKKα and IKKβ, thus blocking TNF-α-induced NF-kB activation. IKKγ NBD Inhibitory Peptide TFA could significantly suppresses inflammation and ameliorate the cerebral ischemia-induced neurological deficits .
|
-
- HY-P1120A
-
|
|
Formyl Peptide Receptor (FPR)
PERK
Apoptosis
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
WKYMVm (TFA) is a selective formylpeptide receptor 2 (FPR2) agonist. WKYMVm has a powerful anti-inflammatory effect that can reduce lung injury and spinal cord injury. WKYMVm ameliorates obesity by regulating lipid metabolism and leptin signaling. WKYMVm is involved in the regulation of immune cells by activating FPRs, and WKYMVm can promote the chemotactic migration of immune cells and inhibit the apoptosis of phagocytes. In addition, WKYMVm may play a favorable or unfavorable role in tumors, depending on the type of tumor .
|
-
- HY-P10580A
-
|
|
Tie
|
Infection
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
Vasculotide TFA, an angiopoietin-1 mimetic, is a Tie-2 activator and induces Tie-2 phosphorylation. Vasculotide has anti-inflammatiory effect and anti-permeability. Vasculotide TFA ameliorates endotoxin-induced endothelial barrier dysfunction. Vasculotide TFA promotes angiogenesis in a mouse model of diabetic ulcer. Vasculotide TFA protects mice from vascular leakage and reduces mortality in murine abdominal sepsis. Vasculotide TFA decreases microvascular leakage and improves microcirculatory perfusion in a rat model of hemorrhagic shock .
|
-
- HY-P1844
-
|
|
Chemerin Receptor
Akt
ERK
Reactive Oxygen Species (ROS)
Amyloid-β
|
Inflammation/Immunology
|
|
Chemerin-9 (149-157) is a potent agonist of chemokine-like receptor 1 (CMKLR1) . Chemerin-9 (149-157) has anti-inflammatory activity. Chemerin-9 (149-157) stimulates phosphorylation of Akt and ERK as well as ROS production. Chemerin-9 (149-157) ameliorates Aβ1-42-induced memory impairmen. Chemerin-9 (149-157) regulates immune responses, adipocyte differentiation, and glucose metabolism .
|
-
- HY-P1120
-
|
|
Formyl Peptide Receptor (FPR)
PERK
Apoptosis
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
WKYMVm is a selective formylpeptide receptor 2 (FPR2) agonist. WKYMVm has a powerful anti-inflammatory effect that can reduce lung injury and spinal cord injury. WKYMVm ameliorates obesity by regulating lipid metabolism and leptin signaling. WKYMVm is involved in the regulation of immune cells by activating FPRs. WKYMVm can promote the chemotactic migration of immune cells and inhibit the apoptosis of phagocytes. In addition, WKYMVm may play a favorable or unfavorable role in tumors, depending on the type of tumor .
|
-
- HY-P1844A
-
|
|
Chemerin Receptor
Akt
ERK
Reactive Oxygen Species (ROS)
Amyloid-β
|
Inflammation/Immunology
|
|
Chemerin-9 (149-157) TFA is a potent agonist of chemokine-like receptor 1 (CMKLR1) . Chemerin-9 (149-157) TFA has anti-inflammatory activity. Chemerin-9 (149-157) TFA stimulates phosphorylation of Akt and ERK as well as ROS production. Chemerin-9 (149-157) TFA ameliorates Aβ1-42-induced memory impairmen. Chemerin-9 (149-157) TFA regulates immune responses, adipocyte differentiation, and glucose metabolism .
|
-
- HY-P5875A
-
|
|
Protease Activated Receptor (PAR)
|
Cardiovascular Disease
Inflammation/Immunology
|
|
P4pal10 TFA is the TFA salt form of P4pal10 (HY-P5875). P4pal10 TFA is an antagonist for protease-activated receptor 4 (PAR4). P4pal10 TFA inhibits the platelet aggregation, inhibits tissue factor (TF)-induced thrombin generation, and exhibits anticoagulant and antithrombotic activities. P4pal10 TFA reduces the oedema and the granulocyte infiltration induced by Carrageenan (HY-125474). P4pal10 TFA ameliorates the injury in rats myocardial ischemia/reperfusion (I/R) models .
|
-
- HY-P11114
-
|
|
Bacterial
p38 MAPK
Reactive Oxygen Species (ROS)
Apoptosis
Caspase
|
Inflammation/Immunology
|
|
Periplanetasin-4 is an antimicrobial peptide that can be derived from the American cockroach (Periplaneta americana). Periplanetasin-4 reduces cell rounding and apoptosis. Periplanetasin-4 blocks Clostridium difficile toxin A-induced ROS production and the activation of downstream p38 MAPK and p21. Periplanetasin-4 significantly increases mitochondrial calcium level, reduces DPH fluorescence intensity and vacuolar dysfunction in Candida albicans ATCC 90028 cells. Periplanetasin-4 significantly ameliorates toxin A-induced mucosal damage in the mouse gut. Periplanetasin-4 can be used for the study of colitis .
|
-
- HY-P5381
-
| Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P99959
-
|
MT-3921; rH116A3
|
TGF-β Receptor
|
Neurological Disease
|
|
Unasnemab (MT-3921) is a humanised IgG1 monoclonal antibody that binds to repulsive guidance molecule A (RGMa). Unasnemab improves locomotor function and promotes neuroregeneration. Unasnemab exerts ameliorative effects on hippocampal neurogenesis impairment and cognitive decline in db/db mice, Streptozotocin (STZ) (HY-13753)-induced type 1 diabetic and bilateral common carotid artery stenosis (BCAS)-induced mice. Unasnemab can be used for the research of spinal cord injury, diabetes-induced neurological impairments .
|
-
- HY-P990116
-
|
|
Osteopontin
|
Inflammation/Immunology
|
|
Anti-Mouse osteopontin/SPP1 Antibody (103D6) is a mouse-derived anti-mouse osteopontin/SPP1 IgG2c κ type antibody inhibitor. Anti-Mouse osteopontin/SPP1 Antibody (103D6) increases cytotoxic T lymphocyte lytic activity and suppresses colon tumor growth. Anti-Mouse osteopontin/SPP1 Antibody (103D6) ameliorates liver injury in common bile duct ligation (CBDL)-induced primary sclerosing cholangitis mice models .
|
-
- HY-P99578
-
|
HL036337; HBM9036
|
TNF Receptor
|
Inflammation/Immunology
|
|
Tanfanercept (HL036337) is an TNF-α receptor fusion protein that targets TNF-α. Tanfanercept is effective in ameliorating corneal erosions in a dry eye (DE) mouse model .
|
-
- HY-P991637
-
|
|
Ser/Thr Protease
|
Metabolic Disease
|
|
REGN7999 is a monoclonal antibody that inhibits TMPRSS6. REGN7999 inhibits TMPRSS6 activity, preventing Hemojuvelin (HJV) lysis, thereby enhancing BMP6-HJV signaling and increasing serum hepcidin. REGN7999 ameliorates iron overload and impaired erythropoiesis in a β-thalassemia mouse model by inhibiting TMPRSS6 activity. REGN7999 is indicated for research in β-thalassemia .
|
| Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
-
- HY-125120
-
-
-
- HY-N1485
-
|
Astramembrangenin; Cyclosieversigenin
|
Triterpenes
other families
Terpenoids
Source classification
Plants
|
Telomerase
|
|
Cycloastragenol (Astramembrangenin), the active form of astragaloside IV, has anti-oxidant, anti-inflammatory, anti-aging, anti-apoptotic, and cardiovascular protective effects. Cycloastragenol is a potent telomerase activator and can lengthen telomeres. Cycloastragenol alleviates age-related bone loss and improves bone microstructure and biomechanical properties .
|
-
-
- HY-N1458
-
-
-
- HY-N3182
-
-
-
- HY-N9349
-
-
-
- HY-N0785
-
-
-
- HY-N7981
-
-
-
- HY-N15152
-
-
-
- HY-N1458R
-
-
-
- HY-N1485R
-
|
Astramembrangenin (Standard); Cyclosieversigenin (Standard)
|
Triterpenes
other families
Terpenoids
Source classification
Plants
|
Reference Standards
Telomerase
|
|
Cycloastragenol (Standard) is the analytical standard of Cycloastragenol. This product is intended for research and analytical applications. Cycloastragenol (Astramembrangenin), the active form of astragaloside IV, has anti-oxidant, anti-inflammatory, anti-aging, anti-apoptotic, and cardiovascular protective effects. Cycloastragenol is a potent telomerase activator and can lengthen telomeres. Cycloastragenol alleviates age-related bone loss and improves bone microstructure and biomechanical properties .
|
-
-
- HY-N4244
-
-
-
- HY-N3710
-
-
-
- HY-118824A
-
-
-
- HY-N3674
-
-
-
- HY-N3006R
-
-
-
- HY-N3006
-
-
-
- HY-121401A
-
-
-
- HY-N10496
-
-
-
- HY-126871
-
-
-
- HY-N13031
-
-
-
- HY-129228
-
-
-
- HY-113919
-
-
-
- HY-N0785R
-
-
-
- HY-118157
-
-
-
- HY-N0901A
-
-
-
- HY-N0045
-
-
-
- HY-N12141
-
-
-
- HY-N1388
-
-
-
- HY-N2707
-
-
-
- HY-N3542
-
-
-
- HY-N6884
-
-
-
- HY-130307
-
-
-
- HY-N1419R
-
|
|
Flavonoids
other families
Flavones
Source classification
Phenols
Polyphenols
Plants
|
Reference Standards
AMPK
|
|
Vaccarin (Standard) is the analytical standard of Vaccarin. This product is intended for research and analytical applications. Vaccarin is an active flavonoid glycoside associated with various biological functions. Vaccarin significantly promote wound healing and endothelial cells and fibroblasts proliferation in the wound site. Vaccarin ameliorates insulin resistance and steatosis by activating the AMPK signaling pathway .
|
-
-
- HY-N0278
-
|
Pulsatilla camphor; Anemonine; trans-Anemonin
|
Natural Products
Source classification
Ranunculaceae
Clematis crassifolia Benth.
Plants
|
PKC
NO Synthase
|
|
Anemonin (Pulsatilla camphor), a selective iNOS inhibitor, is also a PKC-θ inhibitor. Anemonin can significantly inhibit the translation or protein stability of PKC-θ protein. Anemonin also ameliorates dextran sodium sulfate-induced acute ulcerative colitis (UC) in mice. Anemonin can be used in the research of inflammation-related diseases .
|
-
-
- HY-B0412
-
-
-
- HY-101546A
-
-
-
- HY-N0901AR
-
-
-
- HY-113829
-
|
|
Natural Products
Animals
Source classification
|
Antibiotic
Bacterial
|
|
Valnemulin is an orally active broad-spectrum antibiotic against Gram-negative and Gram-positive bacteria, anaerobic bacteria, Mycoplasma, and Spirochetes. Valnemulin ameliorates enteric diseases, acute polyarthritis and enzootic pneumonia in pigs . Valnemulin exhibits anti-inflammatory efficacy against lipopolysaccharide (HY-D1056)-induced lung injury .
|
-
-
- HY-N11872
-
|
|
Paeonia lactiflora Pall.
Source classification
Phenols
Polyphenols
Plants
Paeoniaceae
|
Others
|
|
Suffruticosol A is a neuroprotective agent that restores scopolamine-induced cellular neurodegenerative damage. Suffruticosol A ameliorates hippocampal cholinergic deficits and partially enhances BDNF signaling. Suffruticosol A has neuromodulatory effects in a Scopolamine (HY-N0296)-induced model, restoring memory and cognitive performance in mice. Suffruticosol A can be isolated from seeds of P. lactiflora .
|
-
-
- HY-N0261
-
-
-
- HY-N8441
-
-
-
- HY-119347
-
-
-
- HY-N1388R
-
-
-
- HY-76632
-
-
-
- HY-N6884R
-
-
-
- HY-B0399
-
-
-
- HY-B2246
-
-
-
- HY-N10405
-
-
-
- HY-W087952R
-
|
|
Natural Products
Microorganisms
Source classification
|
Drug Intermediate
Reference Standards
|
|
Ginsenoside Rg1 (Standard) is the analytical standard of Ginsenoside Rg1. This product is intended for research and analytical applications. Ginsenoside Rg1 is one of the major active components of Panax ginseng. Ginsenoside Rg1 ameliorates the impaired cognitive function, displays promising effects by reducing cerebral Aβ levels. Ginsenoside Rg1 also reduces NF-κB nuclear translocation.
|
-
-
- HY-129752
-
|
|
Microorganisms
Antibiotics
Source classification
Other Antibiotics
|
Antibiotic
|
|
Piperafizine B exhibits slightly cytotoxicity in moser cells, P388 cells and Vincristine (VCR) (HY-N0488)-resistant P388 cells (IC50s is 23.8, 22.6 and 23.7 μg/mL, respectively). Piperafizine B exhibits synergistic effects with Vincristine, enhances the VCR-induced cytotoxicity and ameliorates the leukemia in mouse model .
|
-
- HY-N0045R
-
-
- HY-N4090
-
-
- HY-N0353R
-
|
(+)-Curdione (Standard)
|
Terpenoids
Sesquiterpenes
Source classification
Curcuma phaeocaulis Valeton
Plants
Zingiberaceae
|
Reference Standards
Ferroptosis
Apoptosis
Reactive Oxygen Species (ROS)
Autophagy
Glutathione Peroxidase
Keap1-Nrf2
Heme Oxygenase (HO)
TGF-β Receptor
Indoleamine 2,3-Dioxygenase (IDO)
|
|
Curdione (Standard) is the analytical standard of Curdione. This product is intended for research and analytical applications. Curdione ((+)-Curdione) is an orally active sesquiterpenoid. Curdione inhibits platelet aggregation. Curdione induces ferroptosis in colorectal cancer via m6A methylation mediated by METTL14 and YTHDF2. Curdione inhibits ferroptosis in Isoproterenol (HY-B0468)-induced myocardial infarction by regulating the Keap1/Trx1/GPX4 signaling pathway, suppressing oxidative stress (ROS) and apoptosis. Curdione ameliorates Doxorubicin (HY-15142)-induced cardiotoxicity by inhibiting oxidative stress (ROS) and activating the Nrf2/HO-1 pathway. Curdione ameliorates sepsis-induced lung injury by inhibiting platelet-mediated neutrophil extracellular trap formation. Curdione ameliorates Bleomycin (HY-17565A)-induced pulmonary fibrosis by inhibiting TGF-β-induced fibroblast-to-myofibroblast differentiation. Curdione exhibits neuroprotective effects against focal cerebral ischemia-reperfusion injury in rats. Curdione exerts antiproliferative effects against human uterine leiomyosarcoma by targeting IDO1. Curdione protects vascular endothelial cells and atherosclerosis by regulating DNMT1-mediated ERBB4 promoter methylation. Curdione inhibits inducible prostaglandin E2 production (IC50 = 1.1 μM) and cyclooxygenase 2 expression .
|
-
- HY-N0353
-
-
- HY-133865
-
-
- HY-N9942
-
-
- HY-N0236
-
-
- HY-N0278A
-
|
(Rac)-Pulsatilla camphor; (Rac)-Anemonine
|
Natural Products
Ranunculaceae
Source classification
Clematis crassifolia Benth.
Plants
|
PKC
NO Synthase
|
|
(Rac)-Anemonin ((Rac)-Pulsatilla camphor) is the diastereoisomer of Anemonin (HY-N0278). Anemonin (Pulsatilla camphor), a selective iNOS inhibitor, is also a PKC-θ inhibitor. Anemonin can significantly inhibit the translation or protein stability of PKC-θ protein. Anemonin also ameliorates dextran sodium sulfate-induced acute ulcerative colitis (UC) in mice. Anemonin can be used in the research of inflammation-related diseases .
|
-
- HY-N1876
-
-
- HY-N4192
-
-
- HY-N0202
-
-
- HY-N2453
-
-
- HY-119347R
-
-
- HY-N4090R
-
-
- HY-N1524
-
-
- HY-N0261R
-
-
- HY-N5159
-
|
|
Microorganisms
Antibiotics
Source classification
Other Antibiotics
|
iGluR
|
|
Ampullosporin A is a peptaibol-type polypeptide that can be isolated from the fungus Sepedonium ampullosporum HKI-0053, exhibiting neuroleptic-like activity. Ampullosporin A can inhibit hyperactivity induced by NMDA receptor antagonist MK-801 (HY-15084B) and ameliorate social behavior abnormalities caused by subchronic drug treatment. Ampullosporin A alters the activity of glutamate receptors without affecting dopamine D1 and D2 receptors .
|
-
- HY-105174
-
-
- HY-B1021
-
-
- HY-N6973
-
-
- HY-B0399R
-
-
- HY-B2246R
-
|
(R)-Carnitine hydrochloride (Standard); Levocarnitine hydrochloride (Standard)
|
Ketones, Aldehydes, Acids
Source classification
Endogenous metabolite
|
Reference Standards
Endogenous Metabolite
|
|
L-Carnitine (hydrochloride) (Standard) is the analytical standard of L-Carnitine (hydrochloride). This product is intended for research and analytical applications. L-Carnitine hydrochloride ((R)-Carnitine hydrochloride), a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine hydrochloride functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine hydrochloride is an antioxidant. L-Carnitine hydrochloride can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
- HY-134914
-
|
|
Microorganisms
Antibiotics
Source classification
Other Antibiotics
|
Antibiotic
Parasite
|
|
Fosmidomycin is an orally active antibiotic, which exhibits antimalarial activity through inhibition of 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DOXP reductoisomerase). Fosmidomycin inhibits P. falciparum strains 3D7, HB3, Dd2 and A2, with IC50s of 150, 71, 170 and 150 ng/mL, respectively. Fosmidomycin exhibits synergistic effect with Clindamycin (HY-B1455), and ameliorates malaria in mouse model .
|
-
- HY-N2453R
-
|
|
Triterpenes
Terpenoids
Ranunculaceae
Adonis amurensis Regel et Radde
Plants
|
Reference Standards
PPAR
NF-κB
P-glycoprotein
|
|
Convallatoxin (Standard) is the analytical standard of Convallatoxin. This product is intended for research and analytical applications. Convallatoxin is a cardiac glycoside isolated from Adonis amurensis Regel et Radde. Convallatoxin ameliorates colitic inflammation via activation of PPARγ and suppression of NF-κB. Convallatoxin is a P-glycoprotein (P-gp) substrate and recognized Val982 as an important amino acid involved in its transport. Convallatoxin is an enhancer of ligand-induced MOR endocytosis with high potency and efficacy. Anti-inflammatory and anti-proliferative properties .
|
-
- HY-W016586R
-
|
AT-125 (Standard); U-42126 (Standard)
|
Microorganisms
Ketones, Aldehydes, Acids
Source classification
|
Reference Standards
Parasite
γ-Glutamyl Transferase (GGT)
|
|
Articaine (Standard) is the analytical standard of Articaine. This product is intended for research and analytical applications. Articaine (Hoe-045 free base) is an amide agent that can suppress or relieve pain. containing an ester group, reversibly binding to the α-subunit of the voltage-gated sodium channels within the inner cavity of the nerve, can provide effective pain relief. Articaine ameliorates LPS-induced acute kidney injury via inhibition of NF-κB activation and the NLRP3 inflammasome pathway .
|
-
- HY-N2118
-
-
- HY-N0236R
-
-
- HY-14393
-
-
- HY-N16066
-
|
CHNQD-0803
|
Monophenols
Microorganisms
Source classification
Phenols
|
AMPK
Apoptosis
NF-κB
TNF Receptor
|
|
Candidusin A (CHNQD-0803) (Compound 4) is a AMPK activator with a KD of 47.28 nM. Candidusin A can be isolated from marine fungus Aspergillus candidus. Candidusin A has cytotoxic activity and induces apoptosis in human prostate cancer cells (22Rv1, PC-3 and LNCaP cells). Candidusin A reduces adipogenesis genes expression and fat deposition, negatively regulates the NF-κB-TNFα inflammatory axis to suppress inflammation, and ameliorates liver injury and fibrosis. Candidusin A can be used for non-alcoholic steatohepatitis (NASH) research .
|
-
- HY-129440R
-
|
|
Carthamus tinctorius L.
Source classification
Phenols
Polyphenols
Plants
Compositae
|
PDGFR
ERK
Caspase
|
|
N-(p-Coumaroyl) Serotonin (Standard) is the analytical standard of N-(p-Coumaroyl) Serotonin. This product is intended for research and analytical applications. N-(p-Coumaroyl) Serotonin is a polyphenol isolated from the seeds of safflower and has antioxidative, anti-atherogenic and anti-inflammatory properties. N-(p-Coumaroyl) Serotonin inhibits PDGF-induced on phosphorylation of PDGF receptor and Ca2+ release from sarcoplasmic reticulum . N-(p-Coumaroyl) Serotonin ameliorates atherosclerosis and distensibility of the aortic wall in vivo and is usually used for the atherosclerosis research .
|
-
- HY-N0202R
-
|
Asterolide (Standard)
|
Terpenoids
Sesquiterpenes
Source classification
Astragalus caprinus L.
Plants
Compositae
|
ERK
Reference Standards
Apoptosis
p38 MAPK
Src
Akt
STAT
|
|
Atractylenolide II (Standard) is the analytical standard of Atractylenolide II. This product is intended for research and analytical applications. Atractylenolide II (Asterolide) is a sesquiterpenoid compound. Atractylenolide II can induce G1 phase cell cycle arrest and apoptosis in B16 melanoma cells. Atractylenolide II is an orally effective anticancer agent that can exert anti-melanoma effects by inhibiting the STAT3 signaling pathway. In addition, Atractylenolide II has been shown to ameliorate myocardial fibrosis, oxidative stress, and neuroprotective activity .
|
-
- HY-B0987
-
-
- HY-59291
-
|
N-Acetyl-L-leucine
|
Classification of Application Fields
Ketones, Aldehydes, Acids
Source classification
Metabolic Disease
Endogenous metabolite
Disease Research Fields
|
Amino Acid Derivatives
|
|
Levacetylleucine (N-acetyl-L-leucine), an orally bioavailable and brain-penetrant compound, is an acetylated derivative of amino acid Leucine. Levacetylleucine is the active form of N-acetyl-leucine (NAL). Levacetylleucine attenuates neuronal death and neuroinflammation in the cortical tissue of mice. Levacetylleucine also potentially improves ameliorates lysosomal and metabolic dysfunction. Levacetylleucine improves compensation of postural symptoms after unilateral chemical labyrinthectomy (UL) in rats. Levacetylleucine is promising for research of neurological manifestations of Niemann-Pick disease type C, traumatic brain injury and neurodegeneration prevention .
|
-
- HY-N0755
-
-
- HY-B1021R
-
|
|
Apocynaceae
Alkaloids
Source classification
Eupatorium triplinerve Vahl.
Plants
Catharanthus roseus (L.) G. Don
|
Reference Standards
Free Fatty Acid Receptor
|
|
Vincamine (Standard) is the analytical standard of Vincamine. This product is intended for research and analytical applications. Vincamine is a monoterpenoid indole alkaloid extracted from the Madagascar periwinkle. Vincamine is a peripheral vasodilator and exerts a selective vasoregulator action on the brain microcapilar circulation . Vincamine is a GPR40 agonist and acts as a β-cell protector by ameliorating β-cell dysfunction and promoting glucose-stimulated insulin secretion (GSIS). Vincamine improves glucose homeostasis in vivo, and has the potential for the type 2 diabetes mellitus (T2DM) research .
|
-
- HY-N1940
-
-
- HY-N2118R
-
|
|
Flavonoids
Ginkgoaceae
Source classification
Phenols
Polyphenols
Plants
Biflavones
Ginkgo biloba
|
Reference Standards
PPAR
PKA
Akt
p38 MAPK
ERK
|
|
Bilobetin (Standard) is the analytical standard of Bilobetin. This product is intended for research and analytical applications. Bilobetin, an active component of Ginkgo biloba, can reduce blood lipids and improve the effects of insulin. Bilobetin ameliorated insulin resistance, increased the hepatic uptake and oxidation of lipids, reduced very-low-density lipoprotein triglyceride secretion and blood triglyceride levels, enhanced the expression and activity of enzymes involved in β-oxidation and attenuated the accumulation of triglycerides and their metabolites in tissues. Bilobetin also increased the phosphorylation, nuclear translocation and activity of PPARα accompanied by elevated cAMP level and PKA activity .
|
-
- HY-N6711
-
-
- HY-16561
-
Resveratrol
Maximum Cited Publications
141 Publications Verification
trans-Resveratrol; SRT501
|
Classification of Application Fields
Anti-aging
Source classification
Vitis vinifera cv. Zalema
Plants
Vitaceae
Infection
Microorganisms
Functional Molecules
Sunscreen
Research of Health Products
Phenols
Polyphenols
Cosmetic Research
Inflammation/Immunology
Disease Research Fields
Cancer
|
IKK
Autophagy
Mitophagy
Sirtuin
Apoptosis
Bacterial
Fungal
Antibiotic
Keap1-Nrf2
|
|
Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
-
- HY-N0755R
-
|
|
Rhus succedanea
Flavonoids
Flavones
Plants
Anacardiaceae
|
Reference Standards
Insulin Receptor
GLUT
NF-κB
p38 MAPK
Autophagy
|
|
Rhoifolin (Standard) is the analytical standard of Rhoifolin. This product is intended for research and analytical applications. Rhoifolin is a flavone glycoside can be isolated from Rhus succedanea. Rhoifolin has anti-diabetic effect acting through enhanced adiponectin secretion, tyrosine phosphorylation of insulin receptor-β and glucose transporter 4 (GLUT 4) translocation. Rhoifolin has an anti-inflammatory action via multi-level regulation of inflammatory mediators. Rhoifolin ameliorates titanium particle-stimulated osteolysis and attenuates osteoclastogenesis via RANKL-induced NF-κB and MAPK pathways. Rhoifolin also has cytotoxic activity against different cancer cell lines .
|
-
- HY-14393R
-
-
- HY-16561R
-
|
trans-Resveratrol (Standard); SRT501 (Standard)
|
Infection
Functional Molecules
Classification of Application Fields
Sunscreen
Anti-aging
Source classification
Research of Health Products
Cosmetic Research
Plants
Inflammation/Immunology
Disease Research Fields
Cancer
|
Reference Standards
IKK
Autophagy
Mitophagy
Sirtuin
Apoptosis
Bacterial
Fungal
Antibiotic
Keap1-Nrf2
|
|
Resveratrol (Standard) is the analytical standard of Resveratrol. This product is intended for research and analytical applications. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
-
- HY-114360
-
-
- HY-N2995
-
-
- HY-N2492
-
-
- HY-N3021R
-
|
|
Natural Products
Source classification
Endogenous metabolite
|
Endogenous Metabolite
NF-κB
TNF Receptor
FOXO
Microtubule/Tubulin
|
|
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .
|
-
- HY-N3021
-
|
|
Natural Products
Classification of Application Fields
Source classification
Metabolic Disease
Endogenous metabolite
Disease Research Fields
|
Endogenous Metabolite
NF-κB
TNF Receptor
FOXO
Microtubule/Tubulin
|
|
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .
|
-
- HY-N1916
-
-
- HY-N2492R
-
|
Methyl trans-p-coumarate (Standard)
|
Monophenols
Source classification
Morinda citrifolia Linn.
Rubiaceae
Other Phenylpropanoids
Phenols
Phenylpropanoids
Plants
|
Reference Standards
Apoptosis
Parasite
Interleukin Related
GSK-3
|
|
(E)-Methyl 4-coumarate (Standard) is the analytical standard of (E)-Methyl 4-coumarate (HY-N2492). This product is intended for research and analytical applications. (E)-Methyl 4-coumarate (Methyl 4-hydroxycinnamate) is a phenolic compound and derivative of Cinnamic acid (HY-N0610A). (E)-Methyl 4-coumarate can be found in several plants, such as the leaves of Allium cepa and Morinda citrifolia L. (E)-Methyl 4-coumarate, when combined with Carnosic acid (HY-N0644), induces Apoptosis. (E)-Methyl 4-coumarate inhibits GSK3β activity and modulates inflammatory cytokine levels (increasing IL-10 and decreasing IL-4). (E)-Methyl 4-coumarate combined with Carnosic acid exhibits anticancer effects against acute myeloid leukemia. (E)-Methyl 4-coumarate ameliorates Plasmodium berghei NK65 infection .
|
-
- HY-N2255
-
-
- HY-N6871
-
|
|
Infection
Colophony
Classification of Application Fields
Pinaceae
Ketones, Aldehydes, Acids
Metabolic Disease
Plants
Inflammation/Immunology
Disease Research Fields
|
Bacterial
IKK
Ferroptosis
|
Abietic acid, an orally active diterpene isolated from Colophony, displays significant anti-proliferative, anti-inflammatory, anti-obesity effect, bacteriostatic, cell cycle arresting and pro-apoptotic activities. Abietic acid inhibits lipoxygenase activity for allergy. Abietic acid enhances cell migration and tube formation in HUVECs. Abietic acid induces significant angiogenic potential, which is associated with upregulation of extracellular signal-regulated kinase (ERK) and p38 expression. Abietic acid attenuates sepsis-induced lung injury by inhibiting nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) pathway to inhibit M1 macrophage polarization. Abietic acid exhibits a positive effect against liver injury by attenuating inflammation and ferroptosis. Abietic acid shows accelerated wound closure in a mouse model of cutaneous wounds. Abietic acid significantly reduces the proliferation and growth of NSCLC cells by IKKβ inhibition.Additionally, Abietic acid ameliorates psoriasis-like inflammation and modulates gut microbiota in mice. Abietic acid is promising for research in non-small-cell lung cancer (NSCLC), liver injury-related deseases and psoriasis .
|
-
- HY-N0469R
-
|
|
Microorganisms
Source classification
Disease markers
Endocrine diseases
Amino acids
Nervous System Disorder
Endogenous metabolite
|
Reference Standards
Endogenous Metabolite
Virus Protease
HSV
|
L-Lysine (Standard) is the analytical standard of L-Lysine. This product is intended for research and analytical applications. L-lysine is an essential amino acid for humans with orally activity. L-lysine can inhibit the occurrence of HSV infections and is used in herpes research. L-lysine increases calcium absorption, reduces diabetes-related diseases, improves gut health, and alleviates pancreatic inflammation. L-lysine can be used in research on metabolism, infection, and inflammation .
IC50 & Target:L-lysine (150 mg/kg) promotes, but not initiates, bladder cancer. The administration of L-lysine to rats submitted to colovesical cystoplasty accelerates the development of transitional metaplasia of the intestinal epithelium .
L-lysine (10 mg/kg) treatment attenuates pancreatic tissue injury induced by L-arginine by inhibiting the release of the inflammatory cytokine IL-6 and enhance antioxidant activity .
In Vivo:L-lysine (10?mg/kg, p.o., pre-treated or post-treated, administration duration 15 days) treatment attenuates pancreatic tissue injury induced by L-arginine by inhibiting the release of the inflammatory cytokine IL-6 and enhance antioxidant activity in acute pancreatitis mice model .
L-lysine (5 or 10?mg/kg, p.o., 45 days) ameliorates sepsis-induced acute lung injury in a lipopolysaccharide (HY-D1056)-induced mouse model .
|
-
| Cat. No. |
Product Name |
Chemical Structure |
-
- HY-B0399S
-
1 Publications Verification
|
|
L-Carnitine-d9 is the deuterium labeled L-Carnitine. L-Carnitine (Levocarnitine) is an endogenous molecule involved in fatty acid metabolism, biosynthesized within the human body using amino acids: L-lysine and L-methionine, as substrates. L-Carnitine functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-carnitine can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
-
- HY-B0149S2
-
|
|
|
Tranexamic acid- 13C6 (Cyclocapron- 13C6) is 13C labeled Tranexamic acid. Tranexamic acid (cyclocapron), a cyclic analog of lysine, is an orally active antifibrinolytic agent. Tranexamic acid attenuates the effects of severe trauma, inhibits urokinase plasminogen activator and ameliorates dry wrinkles. Tranexamic acid can used for the research of hemostasis .
|
-
-
- HY-B0702S
-
|
|
|
Nicergoline- 13C,d3 is the 13C- and deuterium labeled Nicergoline. Nicergoline, an ergoline derivative ester of bromonicotinic acid, is a potent, selective and orally active antagonist of α1A-adrenoceptor. Nicergoline has vasodilator effects. Nicergoline also has ameliorative effects on cognitive function in mouse models of Alzheimer's disease .
|
-
-
- HY-W743952
-
|
|
|
Nicergoline-d3 is the deuterium labeled Nicergoline (HY-B0702). Nicergoline, an ergoline derivative ester of bromonicotinic acid, is a potent, selective and orally active antagonist of α1A-adrenoceptor. Nicergoline has vasodilator effects. Nicergoline also has ameliorative effects on cognitive function in mouse models of Alzheimer's disease .
|
-
-
- HY-W707384
-
|
|
|
Candesartan Cilexetil-d11 (TCV-116-d11) is deuterium labeled Candesartan Cilexetil. Candesartan Cilexetil (TCV-116) is an angiotensin II receptor inhibitor. Candesartan Cilexetil ameliorates the pulmonary fibrosis and has antiviral and skin wound healing effect. Candesartan Cilexetil can be used for the research of high blood pressure .
|
-
-
- HY-13458S2
-
|
|
|
Droxidopa- 13C6 (L-DOPS- 13C6) is 13C labeled Droxidopa. Droxidopa (L-DOPS; SM5688) is a potent, orally active norepinephrine precursor. Droxidopa increases standing blood pressure, ameliorates symptoms of orthostatic hypotension and improves standing ability. Droxidopa has the potential for the research of neurogenic orthostatic hypotension (nOH) and alternative ADHD (attention deficit hyperactivity disorder) .
|
-
-
- HY-B2246S
-
|
|
|
L-Carnitine-d9 (chloride)e is the deuterium labeled L-Carnitine chloride. L-Carnitine chloride, a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine chloride functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine chloride is an antioxidant. L-Carnitine chloride can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
-
- HY-W754236
-
|
|
|
(R)-Carnitine Hydrochloride- 13C3 is the 13C-labeled L-Carnitine hydrochloride (HY-B2246). L-Carnitine hydrochloride ((R)-Carnitine hydrochloride), a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine hydrochloride functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine hydrochloride is an antioxidant. L-Carnitine hydrochloride can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
-
- HY-169332
-
|
|
|
Piezo1 agonist 1-d2 (Compound 12a) is an agonist for Piezo1 with an EC50 of 2.21 μM. Piezo1 agonist 1-d2 activates the Ca 2+-related ERK signaling pathway, and thus promotes the osteogenic differentiation of bone marrow mesenchymal stem cells (BMSCs). Piezo1 agonist 1-d2 ameliorates disuse osteoporosis in the hindlimb-unloading (HU) rat model .
|
-
-
- HY-B0399S2
-
|
|
|
L-Carnitine- 13C3 ((R)-Carnitine- 13C3) is the 13C--labeled L-Carnitine (HY-B0399). L-Carnitine ((R)-Carnitine), a highly polar, small zwitterion, is an essential co-factor for the mitochondrial β-oxidation pathway. L-Carnitine functions to transport long chain fatty acyl-CoAs into the mitochondria for degradation by β-oxidation. L-Carnitine is an antioxidant. L-Carnitine can ameliorate metabolic imbalances in many inborn errors of metabolism .
|
-
-
- HY-W011012S1
-
|
|
|
Adenosine 5'-monophosphate-d2 disodium is the deuterium labeled Adenosine 5'-monophosphate (HY-W011012). Adenosine 5'-monophosphate disodium is an orally active purine nucleotide, and participates in ATP metabolism. Adenosine 5'-monophosphate disodium is also a ligand for adenosine 2B receptor. Adenosine 5'-monophosphate disodium can activate AMPK in skeletal muscle, and ameliorates insulin resistance and impaired glucose metabolism. Adenosine 5'-monophosphate disodium can be used for research of diabetes .
|
-
-
- HY-W011012S
-
|
|
|
Adenosine 5'-monophosphate- 13C (disodium) is a 13C-labeled Adenosine 5'-monophosphate (HY-W011012). Adenosine 5'-monophosphate disodium is an orally active purine nucleotide, and participates in ATP metabolism. Adenosine 5'-monophosphate disodium is also a ligand for adenosine 2B receptor. Adenosine 5'-monophosphate disodium can activate AMPK in skeletal muscle, and ameliorates insulin resistance and impaired glucose metabolism. Adenosine 5'-monophosphate disodium can be used for research of diabetes .
|
-
-
- HY-14393S
-
|
|
|
Emodin-d4 is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
|
-
-
- HY-66008S2
-
|
|
|
N-Acetyl mesalazine- 13C6 (N-Acetyl-5-aminosalicylic acid- 13C6) is a deuterated labeled N-Acetyl mesalazine (HY-66008). N-Acetyl mesalazine (N-Acetyl-5-aminosalicylic acid) is the primary intestinal metabolite of 5-Aminosalicylic Acid (HY-15027) and serves as a biomarker for evaluating the efficacy of 5-Aminosalicylic Acid (HY-15027). N-Acetyl mesalazine can scavenge free radicals, reduce DNA base hydroxylation, and ameliorate mucosal inflammation. N-Acetyl mesalazine can be used in the study of diseases such as colitis and colon cancer .
|
-
-
- HY-66008S1
-
|
|
|
N-Acetyl mesalazine-d3-1 (N-Acetyl-5-aminosalicylic acid-d3-1) is deuterium labeled N-Acetyl mesalazine (HY-66008). N-Acetyl mesalazine (N-Acetyl-5-aminosalicylic acid) is the primary intestinal metabolite of 5-Aminosalicylic Acid (HY-15027) and serves as a biomarker for evaluating the efficacy of 5-Aminosalicylic Acid (HY-15027). N-Acetyl mesalazine can scavenge free radicals, reduce DNA base hydroxylation, and ameliorate mucosal inflammation. N-Acetyl mesalazine can be used in the study of diseases such as colitis and colon cancer .
|
-
-
- HY-66008S
-
|
|
|
N-Acetyl mesalazine-d3 (N-Acetyl-5-aminosalicylic acid-d3) is the deuterium labeled N-Acetyl mesalazine (HY-66008). N-Acetyl mesalazine (N-Acetyl-5-aminosalicylic acid) is the primary intestinal metabolite of 5-Aminosalicylic Acid (HY-15027) and serves as a biomarker for evaluating the efficacy of 5-Aminosalicylic Acid (HY-15027). N-Acetyl mesalazine can scavenge free radicals, reduce DNA base hydroxylation, and ameliorate mucosal inflammation. N-Acetyl mesalazine can be used in the study of diseases such as colitis and colon cancer .
|
-
-
- HY-16561S1
-
|
|
|
Resveratrol- 13C6 is the 13C-labeled Resveratrol. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
-
-
- HY-16561S
-
|
|
|
Resveratrol-d4 is the deuterium labeled Resveratrol. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator . Resveratrol is a potent pregnane X receptor (PXR) inhibitor . Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model . Resveratrol increases production of NO in endothelial cells .
|
-
-
- HY-121246S
-
|
|
|
Fluorofenidone-d3 (AKF-PD-d3) is deuterium labeled Fluorofenidone (AKF-PD) (HY-121246). Fluorofenidone is an orally active compound with anti-fibrotic, antioxidant, and anti-inflammatory pharmacological effects. Fluorofenidone downregulates the expression of ACSL4, upregulates GPX4 expression and inhibits the NF-κB signaling pathway to alleviate inflammation and fibrosis. Fluorofenidone ameliorates cholestasis and fibrosis by inhibiting hepatic Erk/-Egr-1 signaling and Tgfβ1/Smad pathway in mice. Fluorofenidone demonstrates protective effects against chronic lung injury in mice. Fluorofenidone can be used for the study of chronic obstructive pulmonary disease (COPD), pulmonary interstitial fibrosis (PIF) and non-small cell lung cancer (NSCLC) .
|
-
-
- HY-W017540S
-
|
|
|
Cyclocreatine- 13C3 is the 13C-labeled Cyclocreatine (HY-W017540). Cyclocreatine, a creatine analogue, acts as a brain-penetrant and potent bioenergetic protective agent by providing high levels of ATP. Cyclocreatine can be phosphorylated and dephosphorylated by creatine kinases. Cyclocreatine suppresses creatine metabolism ameliorating the cognitive, autistic and epileptic phenotype in a mouse model of creatine transporter defciency. Cyclocreatine protects against ischemic injury and enhances cardiac recovery during early reperfusion in dogs and rats. Cyclocreatine decreases plaque-adjacent neuronal dystrophy in TREM2-deficient mice with amyloid-β pathology. Cyclocreatine is proming for research of ischemic heart disease, cardiovascular diseases, Alzheimer’s disease and other neurodegenerative diseases associated with microglial dysfunction, prostate cancer .
|
-
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: