Search Result
Results for "
Disulfide,bis(2,4-dimethylphenyl)
" in MedChemExpress (MCE) Product Catalog:
1
Isotope-Labeled Compounds
Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-W394935
-
Disulfide,bis(2,4-dimethylphenyl)
|
Biochemical Assay Reagents
|
Others
|
Dixylyl disulphide (Disulfide, bis(2,4-dimethylphenyl)) is a 1,2-bis(2,4-dimethylphenyl) thioether that can serve as an impurity reference standard for hydrobromide vortioxetine, used for monitoring impurities in the synthesis process. Hydrobromide vortioxetine is a 5-HT3, 5-HT7, and 5-HT1D receptor antagonist and a 5-HT1A receptor agonist, exhibiting antidepressant activity .
|
-
-
- HY-P1334
-
-
-
- HY-P4058
-
CGRP free acid
|
CGRP Receptor
|
Neurological Disease
|
Calcitonin gene-related peptide (CGRP) free acid is the deamidated form of α-CGRP(human) (HY-P1071). Calcitonin gene-related peptide can be used to study the effect of C-terminal amidation on CGRP .
|
-
-
- HY-108003
-
-
-
- HY-P4062
-
BIL
|
Insulin Receptor
|
Metabolic Disease
|
Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins .
|
-
-
- HY-P5978
-
ANP 127-150 (rat)
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
|
Atriopeptin III (ANP 127-150) (rat), a 24-amino acid atrial peptide, is a potent vasodilator and natriuretic/diuretic agent. Atriopeptin III (rat) improves renal functions and decreases blood pressure in a ureter-obstructed rat kidney model. Atriopeptin III (rat) can be used for research of chronic renal failure .
|
-
-
- HY-P3952
-
|
Somatostatin Receptor
|
Metabolic Disease
|
(D-Trp8,D-Cys14)-Somatostatin-14 is a Somatostatin synthetic analogue. (D-Trp8,D-Cys14)-Somatostatin-14 can be used for the research of metabolic related diseases .
|
-
-
- HY-P4237
-
-
-
- HY-P4204
-
|
Bacterial
|
Infection
|
Ranalexin is an antimicrobial peptide. Ranalexin inhibits S. aureus, E. coli, P. aerugiaosa with MICs of 4, 32, 128 μg/mL .
|
-
-
- HY-P5601
-
|
Bacterial
Fungal
|
Infection
|
Thanatin is an inducible cationic antimicrobial peptide. Thanatin is a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
-
- HY-P5465
-
|
Bacterial
|
Others
|
Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)
|
-
-
- HY-P3062
-
-
-
- HY-P10788
-
|
Complement System
|
Cancer
|
CK3 peptide is an NRP-1 targeting peptide with the amino acid sequence CLKADKAKC. The CK3 peptide specifically binds to NRP-1 to target breast cancer cells. Single-photon emission computed tomography (SPECT) and near-infrared fluorescence (NIRF) imaging show significant accumulation of CK3 peptide in xenograft tumors in nude mice. CK3 peptide can be used for molecular imaging studies of breast cancer.
|
-
-
- HY-P2569
-
|
Apoptosis
|
Cancer
|
Malformin A1, a cyclic pentapeptide isolated from Aspergillus niger, possess a range of bioactive properties including antibacterial activity. Malformin A1 shows potent cytotoxic activities on human colorectal cancer cells. Malformin A1 induces apoptosis by activating PARP, caspase 3, -7, and -9 .
|
-
-
- HY-P1204A
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
[Ala17]-MCH TFA, a MCH analogue (HY-P1525A), is a selective ligand for MCHR1 (Ki=0.16 nM) over MCHR2 (Ki=34 nM). [Eu 3+ chelate-labeled [Ala17]-MCH shows high affnity for MCHR1 (Kd=0.37 nM) while has little demonstrable binding affnity for MCHR2 .
|
-
-
- HY-P4111
-
|
CXCR
|
Cancer
|
Peptide R, a cyclic peptide, is a specific CXCR4 antagonist. Peptide R shows outstanding capacities to profoundly remodel the tumor stroma. Peptide R has the potential for tumor research .
|
-
-
- HY-P1815A
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
-
- HY-P4111A
-
|
CXCR
|
Cancer
|
Peptide R (TFA) is a synthetic and specific CXCR4 antagonist. Peptide R (TFA) shows outstanding capacities to remodel the tumor stroma. Peptide R (TFA) can be used for solid tumor (glioblastoma, etc.) research .
|
-
-
- HY-P2612A
-
|
TNF Receptor
|
Others
Cancer
|
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
|
-
-
- HY-P5659
-
-
-
- HY-P3216
-
9-Deamidooxytocin
|
Oxytocin Receptor
|
Endocrinology
|
Oxytocin free acid (9-Deamidooxytocin) is an analog of oxytocin in which the glycinamide residue at position 9 in oxytocin has been replaced by a glycine residue. Oxytocin is a pleiotropic, peptide hormone with broad implications for general health, adaptation, development, reproduction, and social behavior .
|
-
-
- HY-P5660
-
|
Bacterial
|
Infection
|
Brevinin-2 is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
-
- HY-P2687
-
Urodilatin (human)
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
|
Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure .
|
-
-
- HY-P1334A
-
-
-
- HY-P0122
-
c(CRGDKGPDC)
|
Integrin
|
Cancer
|
iRGD peptide is a 9-amino acid cyclic peptide, triggers tissue penetration of agents by first binding to αv-integrins, then proteolytically cleaved in the tumor to produce CRGDK/R to interact with neuropilin-1, and has tumor-targeting and tumor-penetrating properties.
|
-
-
- HY-P3624
-
|
Guanylate Cyclase
|
Cardiovascular Disease
|
Cenderitide is a potent agonist of particulate guanylyl cyclase receptor (pGC). Cenderitide is a natriuretic peptide (NP) composed of C-type natriuretic peptide (CNP) fused to the C-terminus of Dendroaspis natriuretic peptide (DNP). Cenderitide activates both pGC-A and pGC-B, activates the second messenger cGMP, suppresses aldosterone, and preserves GFR without reducing blood pressure. Cenderitide can be used for heart failure research .
|
-
-
- HY-P5662
-
|
Bacterial
|
Infection
|
Brevinin-2EC is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
-
- HY-P4703
-
|
Oxytocin Receptor
|
Others
|
Hydrin 1′ is found in the neurohypophysis of Xenopus. Hydrin 1′ possesses a considerable steroid-releasing activity in Xenopus adrenal gland in vitro. Hydrin 1′ targets oxytocin receptor and derives a fluorescent probe of the oxytocin receptor .
|
-
-
- HY-P5656
-
|
Bacterial
|
Infection
|
Brevinin-1Ea is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
-
- HY-P1178A
-
|
Trk Receptor
|
Neurological Disease
|
Cyclotraxin B TFA is a BBB-penetrable and selective TrkB inhibitor. Cyclotraxin B TFA inhibits BDNF-induced TrkB activity in a non-competitive manner, with an IC50 of 0.30 nM. Cyclotraxin B TFA has analgesic and anxiolytic effects .
|
-
-
- HY-P3710
-
|
Calcium Channel
|
Others
|
Ser-Ala-alloresact is a sperm activating peptide (SAP). The peptides released from eggs of marine invertebrates play a central role in fertilization .
|
-
-
- HY-P10102
-
Kp7-6
1 Publications Verification
|
Apoptosis
|
Metabolic Disease
Cancer
|
Kp7-6, a Fas mimetic peptide, is a Fas/FasL antagonist. Kp7-6 protects cells from Fas-mediated apoptosis, and protects mice from Fas-mediated hepatic injury .
|
-
-
- HY-P1205A
-
Melanin-concentrating hormone(human, mouse, rat) TFA
|
MCHR1 (GPR24)
|
Neurological Disease
|
MCH (human, mouse, rat) TFA is a potent peptide agonist of MCH-R and exhibits binding IC50 values of 0.3nM and 1.5 nM for MCH1R and MCH2R, respectively. MCH (human, mouse, rat) is a highly sensitive to MCH-2R in a CHO cell line and monitoring mobilization of intracellular calcium with FLIPR, exhibits functional activation EC50 values of 3.9 nM and 0.1nM for human MCH-1R and MCH-2R, respectively .
|
-
-
- HY-P1565
-
TD 1 Disulfide(peptide)
|
Na+/K+ ATPase
|
Inflammation/Immunology
|
Transdermal Peptide Disulfide (TD 1 Disulfide(peptide)) is a 11-amino acid peptide, binds toNa +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide can enhance the transdermal delivery of many macromolecules .
|
-
-
- HY-P3503
-
BMN 111
|
FGFR
|
Others
|
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research .
|
-
-
- HY-P2469
-
-
-
- HY-P5601A
-
|
Bacterial
Fungal
|
Infection
|
Thanatin TFA is an inducible cationic antimicrobial peptide. Thanatin TFA s a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin TFA displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin TFA has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
-
- HY-P1018
-
-
-
- HY-P1205
-
Melanin-concentrating hormone(human, mouse, rat)
|
MCHR1 (GPR24)
|
Neurological Disease
|
MCH (human, mouse, rat) is a potent peptide agonist of MCH-R and exhibits binding IC50 values of 0.3nM and 1.5 nM for MCH1R and MCH2R, respectively. MCH (human, mouse, rat) is a highly sensitive to MCH-2R in a CHO cell line and monitoring mobilization of intracellular calcium with FLIPR, exhibits functional activation EC50 values of 3.9 nM and 0.1nM for human MCH-1R and MCH-2R, respectively .
|
-
-
- HY-P1949
-
|
CXCR
|
Cardiovascular Disease
Cancer
|
Cyclic MKEY is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY also protects against stroke-induced brain injury in mice .
|
-
-
- HY-P1178
-
|
Trk Receptor
p38 MAPK
|
Neurological Disease
|
Cyclotraxin B is a BBB-penetrable and selective TrkB inhibitor. Cyclotraxin B inhibits BDNF-induced TrkB activity in a non-competitive manner, with an IC50 of 0.30 nM. Cyclotraxin B has analgesic and anxiolytic effects .
|
-
-
- HY-P1815
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
-
- HY-P3503A
-
BMN 111 acetate
|
FGFR
|
Others
|
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth .
|
-
-
- HY-P1165
-
-
-
- HY-P2612
-
|
TNF Receptor
|
Others
|
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
|
-
-
- HY-P1949A
-
|
CXCR
|
Cardiovascular Disease
Cancer
|
Cyclic MKEY TFA is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY TFA also protects against stroke-induced brain injury in mice .
|
-
-
- HY-P1204
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
[Ala17]-MCH, a MCH analogue (HY-P1525A), is a selective ligand for MCHR1 (Ki=0.16 nM) over MCHR2 (Ki=34 nM). [Eu 3+ chelate-labeled [Ala17]-MCH shows high affnity for MCHR1 (Kd=0.37 nM) while has little demonstrable binding affnity for MCHR2 .
|
-
-
- HY-P5658
-
|
Bacterial
|
Infection
|
Brevinin-1E is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
-
- HY-P3898
-
-
-
- HY-P3066
-
d(CH2)5Tyr(Et)VAVP
|
Vasopressin Receptor
|
Metabolic Disease
|
SKF 100398 (d(CH2)5Tyr(Et)VAVP), an arginine vasopressin (AVP) analogue, is a specific antagonist of the antidiuretic effect of exogenous and endogenous AVP .
|
-
- HY-P1791B
-
Lactoferricin B acetate; Lfcin B acetate
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B) acetate, a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 acetate has antitumor activities .
|
-
- HY-P5322
-
|
Transmembrane Glycoprotein
|
Cardiovascular Disease
Cancer
|
Thrombospondin (TSP-1)-derived CD36 binding motif is a bioactive hexapeptide. Thrombospondin (TSP-1)-derived CD36 binding motif interferes with the interaction between cells and the extracellular matrix by binding to CD36 and angiostatin, thereby affecting the cell adhesion and migration process. Thrombospondin (TSP-1)-derived CD36 binding motif inhibits platelet aggregation. Thrombospondin (TSP-1)-derived CD36 binding motif exerts an anti-tumor effect against colon cancer .
|
-
- HY-P10320
-
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
|
-
- HY-P4680
-
|
MCHR1 (GPR24)
|
Neurological Disease
|
(Phe13,Tyr19)-MCH (human, mouse, rat) is a potent SLC-1 and S643b receptor ligand. (Phe13,Tyr19)-MCH (human, mouse, rat) can be used as an agonist for SLC-1 and S643b receptor .
|
-
- HY-P10259
-
pBNP-32
|
Natriuretic Peptide Receptor (NPR)
|
Neurological Disease
|
BNP(1-32), porcine (pBNP-32) is a cardiac hormone. BNP(1-32), porcine is an atrial natriuretic peptide, which exhibits natriuretic, diuretic and vasorelaxant effects. BNP(1-32), porcine affects passive avoidance learning in rats with dopaminergic, cholinergic, α-and β-adrenergic mediation .
|
-
- HY-P2545
-
-
- HY-P5188A
-
-
- HY-P0203B
-
-
- HY-P3557
-
-
- HY-P1573A
-
-
- HY-P1390A
-
|
Vasopressin Receptor
|
Endocrinology
|
d[Cha4]-AVP TFA is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP TFA shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
-
- HY-P10388
-
|
CD47
TGF-β Receptor
|
Cancer
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
-
- HY-P1525A
-
MCH (salmon) (TFA)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
-
- HY-P4159
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P1420
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
-
- HY-P10833
-
|
VEGFR
PI3K
Akt
mTOR
ERK
Apoptosis
|
Cardiovascular Disease
Cancer
|
C-VGB3 is a selective vascular endothelial growth factor receptor 2 (VEGFR2) antagonist, which inhibits VEGFR2-mediated PI3K/AKT/mTOR and PLCγ/ERK1/2 signaling pathways. C-VGB3 binds to the extracellular domain of VEGFR2, blocking ligand-receptor interaction and inducing apoptosis in endothelial and tumor cells through both intrinsic (involving Bcl2 family and caspases) and extrinsic (death receptor-mediated) pathways. C-VGB3 is promising for research of angiogenesis-related cancers, such as breast cancer .
|
-
- HY-P3557A
-
-
- HY-P1164
-
-
- HY-P3217
-
|
Oxytocin Receptor
|
Endocrinology
|
[Asp5]-Oxytocin is the first 5-position neurohypophyseal hormone analogue possessing significant biological activity. [Asp5]-Oxytocin causes uterine contractions in vitro, enhanced by Mg 2+. [Asp5]-Oxytocin has the ability of rat uteroconstrictor, avian vasodilator, and rat antidiuretic .
|
-
- HY-P2196
-
-
- HY-P2093
-
S961
5 Publications Verification
|
Insulin Receptor
|
Metabolic Disease
|
S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
-
- HY-P1164A
-
-
- HY-P1547
-
|
GHSR
|
Neurological Disease
|
Somatostatin-25 is a endogenous neuropeptide hormone that shows inhibitory activity against secretion of growth hormone.
|
-
- HY-17571
-
α-Hypophamine; Oxytocic hormone
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
Oxytocin (α-Hypophamine; Oxytocic hormone) is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
-
- HY-P10793
-
|
EGFR
Apoptosis
|
Cancer
|
Cyclic(YCDGFYACYMDV) is a HER2 signaling pathway inhibitor with anti-cancer activity. This compound self-assembles into nanoparticles in aqueous solution and transforms into nanofibers upon specific binding to HER2 on cancer cells. This transformation disrupts HER2 dimerization and subsequent downstream signaling events, leading to cancer cell apoptosis (Apoptosis). The inhibitory effects on HER2 positive breast cancer have been demonstrated to be effective in a murine xenograft model .
|
-
- HY-P1556
-
|
PKG
|
Cardiovascular Disease
|
Vasonatrin Peptide (VNP) is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
-
- HY-P2249
-
|
Arrestin
Apelin Receptor (APJ)
|
Cardiovascular Disease
|
ELA-21 (human) is an apelin receptor agonist with a pKi of 8.52. ELA-21 (human) completely inhibits Forskolin-induced cAMP production and stimulates β-arrestin recruitment with subnanomolar potencies. ELA-21 (human) is an agonist in G-protein-dependent and -independent pathways .
|
-
- HY-P1071A
-
Calcitonin gene-related peptide TFA
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) (TFA) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) (TFA) is widely distributed in the central and peripheral nervous system. α-CGRP(human) (TFA) is a potent vasodilator and has inotropic and chronotropic effects .
|
-
- HY-P1789A
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P3217A
-
|
Oxytocin Receptor
|
Endocrinology
|
[Asp5]-Oxytocin acetate is the first 5-position neurohypophyseal hormone analogue possessing significant biological activity. [Asp5]-Oxytocin acetate causes uterine contractions in vitro, enhanced by Mg 2+. [Asp5]-Oxytocin acetate has the ability of rat uteroconstrictor, avian vasodilator, and rat antidiuretic .
|
-
- HY-P10835
-
|
LAG-3
|
Cancer
|
LAG-3 cyclic peptide inhibitor C25 is a LAG-3 inhibitor. LAG-3 cyclic peptide inhibitor C25 has a high affinity with human LAG-3 protein with a Kd value of 0.66 μM. LAG-3 cyclic peptide inhibitor C25 can block the interaction of LAG-3 with HLA-DR (MHC-II) and activate CD8 + T cells. LAG-3 cyclic peptide inhibitor C25 can be used in the study of cancer .
|
-
- HY-P5718
-
|
Bacterial
|
Infection
|
Brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Brevinin-1PMa also shows hemolytic activity .
|
-
- HY-P3218A
-
|
Drug Derivative
|
Endocrinology
|
[Glu4]-Oxytocin acetate is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of oxytocin-like molecules in aqueous solution .
|
-
- HY-P2196A
-
|
Apelin Receptor (APJ)
|
Cancer
|
ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.
|
-
- HY-P1420A
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY TFA is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY TFA disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
-
- HY-P1235
-
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
|
-
- HY-P1519B
-
BNP (1-32), rat acetate
|
Angiotensin Receptor
|
Cardiovascular Disease
|
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
-
- HY-P3915
-
|
Bacterial
|
Infection
|
Esculentin 1A is a frog skin-derived antimicrobial peptide (AMP) with potent in vitro anti-Pseudomonas activity .
|
-
- HY-P3221
-
|
Oxytocin Receptor
|
Endocrinology
|
[Leu3]-Oxytocin, an oxytocin analogue, is derived by structural variation in sequence position 3 replaced by leucine (Leu) .
|
-
- HY-P10557
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
DAG peptide is a cyclic peptide. DAG peptide selectively recognizes a subset of astrocytes that are activated in Alzheimer's disease (AD) starting at an early stage of the disease. DAG peptide can be used as a tool to enhance the delivery of therapeutics and imaging agents to sites of vascular changes and astrogliosis in diseases associated with neuroinflammation .
|
-
- HY-P1236A
-
Atrial natriuretic factor (1-28) (rat, mouse) TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
-
- HY-P1112A
-
|
Endothelin Receptor
|
Cardiovascular Disease
Neurological Disease
|
Sarafotoxin S6a TFA , a sarafotoxin analogue, is a endothelin receptor agonist and has an ETA/ETB selectivity profile similar to that of Endothelin-3 (HY-P0204). Sarafotoxin S6a TFA elicits the pig coronary artery with an EC50 value of 7.5 nM .
|
-
- HY-P4911
-
|
CXCR
|
Cardiovascular Disease
|
SDF-1α (human) is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) can be used in cardiovascular disease research .
|
-
- HY-P4911A
-
|
CXCR
|
Cardiovascular Disease
|
SDF-1α (human) TFA is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) TFA can be used in cardiovascular disease research .
|
-
- HY-P5713
-
|
Bacterial
|
Infection
|
Des(8-14)brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Des(8-14)brevinin-1PMa also shows hemolytic activity .
|
-
- HY-P1212
-
CST-14 (mouse, rat)
|
Somatostatin Receptor
|
Neurological Disease
|
Cortistatin 14, mouse, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus .
|
-
- HY-P4308
-
|
Prolyl Endopeptidase (PREP)
|
Neurological Disease
|
Z-Pro-Pro-aldehyde-dimethyl acetal is a potent inhibitor of prolyl endopeptidase (PREP), a cytoplasmic serine endoprotease (IC50= 12 nM). Z-Pro-Pro-aldehyde-dimethyl acetal plays an important role in cognitive dysfunction in aging and neurodegenerative diseases including Alzheimer's disease .
|
-
- HY-P5011
-
-
- HY-P5792
-
ANP (3-28) (human)
|
Endothelin Receptor
|
Cardiovascular Disease
Metabolic Disease
|
Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)) is a peptide hormone that is synthesized and secreted by the atrial myocardium. Atrial natriuretic peptide (3-28) (human) is involved in the regulation of blood pressure, fluid balance, and electrolyte homeostasis .
|
-
- HY-P2093B
-
|
Insulin Receptor
|
Metabolic Disease
|
S961 acetate is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
-
- HY-P1525
-
MCH (salmon)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
-
- HY-P11074
-
|
Bacterial
|
Infection
|
Sakacin P is an antimicrobial peptide that targets Gram-positive bacteria (such as Listeria monocytogenes) and belongs to Class IIa bacteriocin. Sakacin P has almost no antimicrobial activity against Gram-negative bacteria. Sakacin P exerts its antimicrobial activity by interacting with bacterial cell membranes and destroying membrane integrity. Sakacin P can be used for the study of Listeria contamination and antimicrobial drugs in the food industry.
|
-
- HY-P1508A
-
Bactenecin, bovine TFA
|
Bacterial
Fungal
|
Infection
|
Bactenecin TFA (Bactenecin, bovine TFA) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin TFA inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin TFA increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei .
|
-
- HY-P0058B
-
-
- HY-P1508
-
Bactenecin, bovine
|
Bacterial
Fungal
Antibiotic
|
Infection
|
Bactenecin (Bactenecin, bovine) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei .
|
-
- HY-P0058
-
-
- HY-P5127
-
-
- HY-P10828
-
|
Virus Protease
|
Infection
Inflammation/Immunology
|
MAPI is a polypeptide irreversible 3C cysteine protease (SV3CP) inhibitor. MAPI inhibits SV3CP by covalently binding its C-terminal Michael-acceptor extension to the active site thiol of SV3CP Cys 139. MAPI is promising for research of noroviruses infection .
|
-
- HY-P1237A
-
-
- HY-P10826
-
|
PD-1/PD-L1
|
Cancer
|
PD-1/PD-L1 inhibitory peptide C8 is inhibits PD-1/PD-L1 interaction, promotes the activation of CD8+ and CD4+ T cells, and increases the IFN-γ secretion. PD-1/PD-L1 inhibitory peptide C8 exhibits antitumor efficacy in mouse model .
|
-
- HY-P3226
-
|
IGF-1R
|
Metabolic Disease
|
JB-1, an IGF-1 peptide analog, is a selective and potent IGF-1R antagonist. JB-1 competes with IGF-1 by binding the IGF-1 receptor. JB-1 prevents the autophosphorylation of IGF-1R, and has no activity in IGF-II .
|
-
- HY-P4588
-
|
GLUT
|
Metabolic Disease
|
(Glu17,21,24)-Osteocalcin (1-49) (human) is a bone-specific protein involved in bone formation and glucose metabolism .
|
-
- HY-P3954
-
|
Somatostatin Receptor
|
Metabolic Disease
|
Somatostatin-28 (sheep, human rat mouse) is a biologically active polypeptide, synthesised in the proximal intestinal epithelial cells. Somatostatin-28 (sheep, human rat mouse) suppresses glucose-stimulated insulin secretion without affecting circulating basal insulin concentration. Somatostatin-28 (sheep, human rat mouse) also targets to somatostatin receptor subtype 5 (SSTR5) to regulate GLP-1 secretion .
|
-
- HY-P5624
-
|
Bacterial
|
Infection
|
Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 μM concentration .
|
-
- HY-P1753
-
|
HIV
|
Infection
|
VIR-165 is a modified form of virus inhibitory peptide (VIRIP) that binds the fusion peptide of the gp41 subunit and prevents its insertion into the target membrane. VIRIP inhibits a wide variety of human immunodeficiency virus type 1 (HIV-1) strains .
|
-
- HY-P1565A
-
TD 1 Disulfide(peptide) TFA
|
Na+/K+ ATPase
|
Others
|
Transdermal Peptide Disulfide TFA (TD 1 Disulfide(peptide) TFA) is a 11-amino acid peptide, binds to Na +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide TFA can enhance the transdermal delivery of many macromolecules .
|
-
- HY-P1519
-
BNP (1-32), rat
|
Angiotensin Receptor
|
Cardiovascular Disease
|
Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
-
- HY-P1179A
-
|
Guanylate Cyclase
Endogenous Metabolite
|
Metabolic Disease
|
Guanylin(human) TFA, a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) TFA is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism .
|
-
- HY-P3627
-
|
Drug Derivative
|
Cancer
|
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis .
|
-
- HY-P2250
-
ELA-32 negative control
|
Apelin Receptor (APJ)
|
Others
|
ELA RR>GG (ELA-32 negative control), an ELABELA (ELA-32 human) mutant peptide, is inactive. ELA RR>GG is a negative control for ELABELA (HY-P2196) .
|
-
- HY-P10260
-
-
- HY-P10248
-
|
Androgen Receptor
|
Endocrinology
|
Atriopeptin I rat, mouse is an atrial natriuretic peptide, which stimulates the testosterone production with half-maximum stimulation of 38 nM .
|
-
- HY-P3912A
-
|
Interleukin Related
|
Infection
|
Endotoxin inhibitor TFA is a synthetic peptide that binds lipid A with high affinity, thereby detoxifying LPS (HY-D1056) and preventing LPS-induced cytokine release in vivo. Endotoxin inhibitor TFA inhibits the febrile response to LPS with very low toxicity and lethality .
|
-
- HY-P1526
-
-
- HY-P1071
-
Calcitonin gene-related peptide
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) (Calcitonin gene-related peptide) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) is a potent vasodilator and has inotropic and chronotropic effects .
|
-
- HY-P1237
-
|
Histamine Receptor
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
|
C-Type Natriuretic Peptide (CNP) (1-22), human, a 1-22 fragment of CNP, is a natriuretic peptide receptor B (NPR-B) agonist. C-Type Natriuretic Peptide (CNP) (1-22), human inhibits cAMP synthesis stimulated by the physiological agonists histamine and 5-HT or directly by Forskolin. CNP is a potent, endothelial-derived relaxant and growthinhibitory factor .
|
-
- HY-P1573
-
-
- HY-P1791
-
Lactoferricin B; Lfcin B
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B), a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 has antitumor activities .
|
-
- HY-P2526
-
LyP-1
2 Publications Verification
|
Complement System
|
Cancer
|
LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
- HY-P2273
-
|
CGRP Receptor
|
Metabolic Disease
|
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research .
|
-
- HY-P1179
-
|
Guanylate Cyclase
Endogenous Metabolite
|
Endocrinology
Cancer
|
Guanylin(human), a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism .
|
-
- HY-P1235A
-
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Carperitide acetate (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide acetate inhibits endothelin-1 secretion in a dose-dependent way.
|
-
- HY-P0203A
-
CGRP (83-119), mouse, rat TFA
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
α-CGRP (mouse, rat) TFA, a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) TFA can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) TFA has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
-
- HY-P4159B
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) acetate is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) acetate is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P3218
-
|
Oxytocin Receptor
|
Endocrinology
|
[Glu4]-Oxytocin is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of “oxytocin-like” molecules in aqueous solution .
|
-
- HY-P1236
-
Atrial natriuretic factor (1-28) (rat, mouse)
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
-
- HY-P0003
-
Brain Natriuretic Peptide-32 human; BNP-32
|
Natriuretic Peptide Receptor (NPR)
Calcium Channel
|
Cardiovascular Disease
|
Nesiritide (Brain Natriuretic Peptide-32 human) is a recombinant human B-type natriuretic peptide. Nesiritide is a NPRs agonist, with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide regulates V1/2 activation/inactivation of the L-type calcium channel. Nesiritide shows vasodilatory, diuretic, and natriuretic activities. Nesiritide is used in cardiovascular diseases such as heart failure and vascular remodeling after arterial injury .
|
-
- HY-P3957
-
|
Urotensin Receptor
|
Others
|
Urotensin II, teleost fish is a cyclic peptide. It can be isolated from the caudal neurosecretory system of teleost fish .
|
-
- HY-P3692
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART (55-76), rat is a neuropeptide (55-76 residues of the CART peptide) and constitutes the N-terminal fragments of CART (55-102). CART (55-76), rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (55-76), rat can induce anxiety and stress-related behavior .
|
-
- HY-P0058A
-
-
- HY-P4159A
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P4860
-
|
Akt
Gli
JNK
PKA
|
Metabolic Disease
|
Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway .
|
-
- HY-P10486
-
|
Bacterial
|
Infection
|
AIP-II is a macrocyclic peptide signaling molecule used for quorum sensing, which can be produced be Staphylococcus aureus. AIP-II binds to AgrC-II receptor, regulates the virulence gene expression in Staphylococcus aureus. AIP-II is an antagonist for AgrC-I receptor .
|
-
- HY-P2093A
-
|
Insulin Receptor
|
Metabolic Disease
|
S961 TFA is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
-
- HY-P1556A
-
|
PKG
|
Metabolic Disease
|
Vasonatrin Peptide (VNP) TFA is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide TFA possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide TFA protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
-
- HY-17571A
-
α-Hypophamine acetate; Oxytocic hormone acetate
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
Oxytocin (α-Hypophamine) acetate is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin acetate can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
-
- HY-P4205
-
|
Aminopeptidase
|
Cancer
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
-
- HY-P0084
-
SRIF-14; Somatostatin-14
|
Endogenous Metabolite
|
Cardiovascular Disease
Neurological Disease
|
Cyclic somatostatin (SRIF-14) is a growth hormone-release inhibiting factor used in the research of severe, acute hemorrhages of gastroduodenal ulcers. Cyclic somatostatin is a neuropeptide co-stored with acetylcholine in the cardiac parasympathetic innervation, exerts influences directly on contraction of ventricular cardiomyocytes. Cyclic somatostatin inhibits the contractile response of isoprenaline with an IC50 value of 13 nM. Cyclic somatostatin can be used for the research of cardiovascular disease .
|
-
- HY-P3707
-
|
Apoptosis
|
Cancer
|
Tumor targeted pro-apoptotic peptide (CNGRC-GG-D(KLAKLAK)2) is an anti-tumor peptide. Tumor targeted pro-apoptotic peptide disrupts mitochondrial membranes and promotes apoptosis, showing anticancer activity in mice .
|
-
- HY-P0203
-
CGRP (83-119), mouse, rat
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
α-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
-
- HY-P1112
-
-
- HY-P4320
-
|
Integrin
|
Cancer
|
Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys (Disulfide bridge: Cys1-Cys10), a decapeptide containing a cyclic RGD active sequence, is an Integrin αIIbβ3 antagonist that inhibits platelet and Adhesion of proMMP-13 .
|
-
- HY-P4767
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (1-13) (human) is a fragment and a residues within amyloid cores of Amylin (human IAPP). Amylin is a glucose-regulating hormone, deposits as amyloid fibrils in condition of type II diabetes (T2D). Amylin (1-13) (human) has no effect on firbl formation, as it cannot form fibrils by itself .
|
-
- HY-P10323
-
Tumstatin (74-98), human
|
Integrin
FAK
mTOR
Apoptosis
|
Cancer
|
T7 peptide is an endothelial cell-specific inhibitor. T7 peptide interacts with αVβ3 integrin to inhibit the FAK, PI3-kinase, PKB/Akt, and mTOR signaling pathways in endothelial cells, ultimately suppressing protein synthesis and inducing apoptosis .
|
-
- HY-P3912
-
|
COX
Interleukin Related
|
Infection
|
Endotoxin inhibitor a synthetic peptide that binds lipid A with high affinity, thereby detoxifying LPS (HY-D1056) and preventing LPS-induced cytokine release in vivo. Endotoxin inhibitor inhibits the febrile response to LPS with very low toxicity and lethality .
|
-
- HY-P1789
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P1282A
-
-
- HY-P1632
-
|
Bacterial
|
Infection
Cancer
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
- HY-P1631
-
|
Bacterial
|
Infection
|
Polyphemusin I is a natural antimicrobial peptide with excellent antimicrobial activity against Gram-negative and Gram-positive bacteria. Polyphemusin I contains 18 amino acids and is stabilized into an amphiphilic, antiparallel β-hairpin by two disulfide bridges .
|
-
- HY-P5780
-
|
Sodium Channel
|
Neurological Disease
|
π-TRTX-Hm3a is a 37-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. π-TRTX-Hm3a pH-dependently inhibits acid-sensing ion channel 1a (ASIC1a) with an IC50 of 1-2 nM and potentiates ASIC1b with an EC50 of 46.5 nM .
|
-
- HY-P4605A
-
-
- HY-P10947
-
|
Epigenetic Reader Domain
YAP
|
Cancer
|
MACTIDE-V is an orally active and selective peptide-drug conjugate targeting CD206. MACTIDE-V delivers Verteporfin (HY-B0146) to CD206 + tumor-associated macrophages (TAM) to inhibit the YAP/TAZ signaling pathway, prompting YAP exclusion from the nucleus, inducing TAM polarization toward an anti-tumoral phenotype with enhanced phagocytosis and antigen presentation, and boosting T cell infiltration and NK cell activity. MACTIDE-V suppresses primary tumor growth and lung metastasis in triple-negative breast cancer (TNBC) mouse models .
|
-
- HY-P3314
-
-
- HY-A0182A
-
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
-
- HY-P1440A
-
|
Potassium Channel
|
Neurological Disease
|
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit heart.
|
-
- HY-P1105
-
|
Chloride Channel
|
Neurological Disease
|
GaTx2 is a seletive and a high affinity inhibitor of ClC-2 channels with a voltage-dependent apparent KD of ∼20 pM. GaTx2 is a peptide toxin inhibitor from Leiurus quinquestriatus hebraeus venom. GaTx2 is useful in determining the role and the membrane localization of ClC-2 in specific cell types .
|
-
- HY-P0049A
-
Arg8-vasopressin diacetate; AVP diacetate; ADH
|
Apoptosis
Vasopressin Receptor
|
Neurological Disease
Cancer
|
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
|
-
- HY-P4902
-
|
P-glycoprotein
HIV
|
Infection
|
Retrocyclin-1 is a kind of Theta-defensin. Retrocyclin-1 recognizes and binds to carbohydrate-containing surface molecules, to protect cells from HIV-1 infection. Retrocyclin-1 exhibits high affinity to fetuin, gp120 (Kd=35.4 nM), CD4 (Kd=31 nM), and galactosylceramide (Kd=24.1 nM) .
|
-
- HY-P5824
-
-
- HY-P1218
-
|
Sodium Channel
|
Neurological Disease
|
Phrixotoxin 3 is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
-
- HY-P3981
-
-
- HY-P3155
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
Ac-hMCH(6-16)-NH2 binds to and activates equally well both human MCH receptors present in the brain (non-selective agonist), with IC50 values of 0.16 nM and 2.7 nM for MCH-1R and MCH-2R .
|
-
- HY-P1483
-
-
- HY-P2311
-
-
- HY-P1574
-
Vasotocin, Argiprestocin, Arginine vasotocin
|
Oxytocin Receptor
|
Neurological Disease
|
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family .
|
-
- HY-106262B
-
KAI-9803 hydrochloride; BMS-875944 hydrochloride
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
-
- HY-P3099
-
|
Guanylate Cyclase
|
Cancer
|
Uroguanylin (human) is a natural ligand for the Guanylyl Cyclase (GCC) receptor expressed in metastatic colorectal cancer tumors. Uroguanylin (human) has anti-tumor actions in an animal model for human colon cancer .
|
-
- HY-P10235
-
|
Amylin Receptor
|
Neurological Disease
|
Cyclic AC253 is an antagonist for amylin receptor, with IC50 of 0.3 μM. Cyclic AC253 exhibits neuroprotective efficacy against Aβ toxicity and abrogates Aβ-induced impairment of hippocampal long-term potentiation. Cyclic AC253 penetrate blood-brain barrier (BBB) .
|
-
- HY-P1548
-
Human β-CGRP; CGRP-II (Human)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P3055A
-
DTX-I TFA
|
Potassium Channel
|
Cancer
|
Dendrotoxin-I (DTX-I) TFA is a potent K + channel blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6. Dendrotoxin-I TFA, a neurotoxin, has the potential for cancer research .
|
-
- HY-P4127A
-
-
- HY-P1346A
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
-
- HY-P3979
-
HNP 4
|
Bacterial
|
Infection
|
Defensin HNP 4 (HNP 4) is a single 11 amino acid long fragment of HNP-41-11. Defensin HNP 4 has inhibitory effect against multidrug-resistant and non-resistant strains .
|
-
- HY-P5772
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-II, a 32 amino acid residues including two acidic and two basic residues, is a neurotoxin. Jingzhaotoxin-II inhibits voltage-gated sodium channels (VGSC) that significantly slows rapid inactivation of TTX-resistant (TTX-R) VGSC on cardiac myocytes with the IC50 of 0.26 μM .
|
-
- HY-P4990A
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-108905
-
Human IGF-I; FK 780
|
IGF-1R
|
Metabolic Disease
|
Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies .
|
-
- HY-B1811
-
|
Endogenous Metabolite
|
Neurological Disease
|
Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
|
-
- HY-P2271
-
|
Apelin Receptor (APJ)
|
Cancer
|
MM 54 (compound 5) is a competitive antagonist at APJ, with an IC50 of 93 nM. MM 54 behaves as a potent and selective inhibitor of apelin binding and APLNR activation .
|
-
- HY-P1632A
-
|
Bacterial
|
Infection
Cancer
|
Tachyplesin I TFA is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I TFA exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
- HY-P1305
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior .
|
-
- HY-P1073
-
|
Calcium Channel
Sodium Channel
Potassium Channel
|
Cancer
|
ProTx-I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. ProTx-I is also a potent blocker for voltage-gated Na + channels and inhibits KV 2.1 channels .
|
-
- HY-12554
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
Terlipressin is a vasopressin analogue with potent vasoactive properties. Terlipressin is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin exerts anti-inflammatory and anti-oxidative effects. Terlipressin has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
-
- HY-P5632
-
|
Bacterial
|
Infection
|
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively .
|
-
- HY-P4810
-
T140
|
CXCR
|
Infection
|
Polyphemusin II-Derived Peptide (T140), a CXCR4 inhibitor, shows high inhibitory activity against HIV-1 entry and the inhibitory effect on the binding of an anti-CXCR4 monoclonal antibody (12G5) to CXCR4 .
|
-
- HY-P3037
-
|
Calcium Channel
|
Neurological Disease
|
Imperatoxin A, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, activator of Ca 2+-release channels/ryanodine receptors (RyRs) enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
-
- HY-P4605
-
-
- HY-P1932
-
-
- HY-P1304
-
-
- HY-P2289
-
pBD-1
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
-
- HY-P3525
-
|
Integrin
|
Others
|
G-Pen-GRGDSPCA is an αvβ3-inhibiting RGD peptide. G-Pen-GRGDSPCA can limit neointimal hyperplasia and lumen stenosis after vascular injury, as well as regulate the migration and proliferation of smooth muscle cells. G-Pen-GRGDSPCA can be used in the study of the mechanism of vascular injury repair .
|
-
- HY-P5907
-
|
Opioid Receptor
|
Neurological Disease
|
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain .
|
-
- HY-P5773
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons .
|
-
- HY-P2601A
-
|
CGRP Receptor
|
Others
|
Tyr-α-CGRP (human) TFA is an N-terminally extended human α-CGRP analog. Tyr-α-CGRP (human) TFA can bind to membrane preparations from rat brain and spleen with IC50 values of 0.2 nM and 0.5 nM, respectively, and induce positive chronotropic and inotropic effects in isolated guinea pig right and left atria with EC50 values of 282 nM and 74 nM, respectively. Tyr-α-CGRP (human) TFA also inhibits contractile responses in rat vas deferens with an EC50 value of 1.9 nM .
|
-
- HY-P5017
-
|
Oxytocin Receptor
|
Endocrinology
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
-
- HY-P3235
-
|
Factor VIIa
|
Others
|
E-76 is a peptide with anticoagulant activity. E-76 inhibits blood coagulation by specifically binding to exogenous coagulation factor VIIa (FVIIa). E-76 can be used to study blood coagulation-related diseases .
|
-
- HY-P1548B
-
Human β-CGRP acetate; CGRP-II (Human) (acetate)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P5014
-
-
- HY-P10237
-
|
Calcium Channel
|
Others
|
Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and bone resorption in neonatal rat osteoclasts .
|
-
- HY-103303
-
|
CGRP Receptor
|
Metabolic Disease
|
CRSP-1 is short for calcitonin receptor-stimulating peptide-1. CRSP-1 inhibits osteoclast formation by inhibiting the formation and activity of multinucleated osteoclast .
|
-
- HY-P1282
-
-
- HY-P1427A
-
|
Potassium Channel
|
Neurological Disease
|
Guangxitoxin 1E TFA is the TFA salt form of Guangxitoxin 1E (HY-P1427). Guangxitoxin 1E TFA is a peptide toxin and a selective inhibitor for voltage-gated potassium channel KV2.1 and KV2.2 with IC50 of 1-3 nM. Guangxitoxin 1E TFA enhances glucose-stimulated intracellular calcium ion oscillations and increases insulin secretion in a glucose-dependent manner .
|
-
- HY-P3953
-
-
- HY-P1464
-
Amylin (rat)
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
|
-
- HY-P1304A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(human) TFA is a human satiety factor with potent appetite-suppressing activity. CART(55-102)(human) TFA is closely associated with leptin and neuropeptide Y .
|
-
- HY-P5114A
-
|
Calcium Channel
|
Others
|
Maurocalcine TFA is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine TFA induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine TFA exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine TFA can be applied to in vivo cell tracking or other cell imaging techniques .
|
-
- HY-P1218A
-
|
Sodium Channel
|
Neurological Disease
|
Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
-
- HY-P1070
-
DAP amide, human
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
-
- HY-P1036
-
|
Complement System
|
Others
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-P4008
-
dVDAVP
|
Vasopressin Receptor
|
Endocrinology
|
[Deamino-4-valine, 8-D-arginine]-Vasopressin (dVDAVP) is a highly potent and specific antidiuretic agent possessing protracted effects .
|
-
- HY-12554A
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
Terlipressin diacetate is a vasopressin analogue with potent vasoactive properties. Terlipressin diacetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin diacetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin diacetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
-
- HY-P1574A
-
-
- HY-P5642
-
RC-101
|
Bacterial
|
Infection
|
Retrocyclin-101 is an antimicrobial peptide against of bacterial and viral .
|
-
- HY-P1163A
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
D[LEU4,LYS8]-VP TFA is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP TFA has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
-
- HY-P2302
-
|
Antibiotic
Bacterial
Fungal
|
Infection
|
Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors .
|
-
- HY-P10996
-
Human Neutrophil Peptide-4 TFA
|
Bacterial
SARS-CoV
|
Infection
|
Corticostatin, human (Human Neutrophil Peptide-4) TFA is an antimicrobial peptide with demonstrated antiviral activity. Corticostatin, human TFA can kill Escherichia coli, Streptococcus faecalis, and Candida albicans. Corticostatin, human (HNP-4) TFA is more bactericidal against Gram-negative bacteria than any of HNP-1-3. Corticostatin, human TFA can be isolated from the azurophil granule fraction of discontinuous Percoll gradients .
|
-
- HY-P1871A
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
-
- HY-P0004
-
-
- HY-P1280A
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
-
- HY-P3899A
-
|
Somatostatin Receptor
|
Metabolic Disease
|
[Nle8] Somatostatin (1-28) TFA is a derivative of somatosttin (1-28) with norleucine replacing methionine in position 8. [Nle8] Somatostatin (1-28) TFA increases the amylase release.[Nle8] Somatostatin (1-28) TFA increases the cyclic AMP in pancreatic acini .
|
-
- HY-P4766
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (porcine) is a peptide that regulates vasodilation. Adrenomedullin (porcine) induces endothelium-dependent relaxation in rat aorta with IC50 value of 2.4 nM. Adrenomedullin (porcine) induces endothelium-independent relaxation of porcine coronary arteries with an IC50 of 27.6 nM .
|
-
- HY-P4990
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P5071
-
|
Bacterial
|
Infection
|
EcAMP3 is a hairpin-like peptide. EcAMP3 has antifungal and antibacterial activity. EcAMPs precursor family contains seven identical cysteine motifs: C1XXXC2(11–13)C3XXXC4 .
|
-
- HY-P11008
-
|
Biochemical Assay Reagents
|
Others
|
DX-236 is a macrocyclic peptide with a binding affinity of 1.9 µM to human serum albumin (HSA). DX-236 can fuse with HSV to prolong its circulation in vivo.
|
-
- HY-P3089
-
|
Potassium Channel
|
Others
|
Dendrotoxin K is a Kv1.1 channel blocker. Dendrotoxin K determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
-
- HY-P3055
-
DTX-I
|
Potassium Channel
|
Neurological Disease
Cancer
|
Dendrotoxin-I (DTX-I) is a potent K + channels blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6, respectively. Dendrotoxin-I, a neurotoxin, has the potential for cancer research .
|
-
- HY-P1346
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
-
- HY-P1305A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior .
|
-
- HY-P1280
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
-
- HY-P10033
-
|
Ser/Thr Protease
|
Others
|
SFTI-1 is a cyclic peptide trypsin inhibitor consisting of 14 amino acid residues. SFTI-1 belongs to the Bowman-Birk class of inhibitors. Characterized by its small size, high stability, and potent activity, SFTI-1 can be used for research on peptide drug design platforms .
|
-
- HY-P5584
-
-
- HY-P4853
-
-
- HY-P1221A
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II TFA is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
-
- HY-P5790
-
|
Sodium Channel
|
Neurological Disease
|
μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II .
|
-
- HY-P5647
-
|
Bacterial
|
Infection
|
PhD1 is an antimicrobial peptide derived from monkey white blood cells. PhD1 has activity against bacteria and fungus Candida albicans .
|
-
- HY-P1168
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
[Orn8]-Urotensin II (human), a peptide analog of urotensin II, is a UT receptor agonist. [Orn8]-Urotensin II (human) increases intracellular calcium levels in HEK293 .
|
-
- HY-P1534
-
-
- HY-P1070A
-
DAP amide, human TFA
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
-
- HY-P5781
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1b is a 42-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. δ-Theraphotoxin-Hm1b selectively inhibits inactivation of NaV1.1 but have no effect on NaV1.7 .
|
-
- HY-P1440
-
-
- HY-106262
-
KAI-9803; BMS-875944
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
Delcasertib (KAI-9803) is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
-
- HY-P10079
-
-
- HY-P1913A
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
-
- HY-P1163
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
D[LEU4,LYS8]-VP is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
-
- HY-P1913
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
-
- HY-P1167A
-
-
- HY-P0049
-
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
-
- HY-P10817
-
|
Proton Pump
Reactive Oxygen Species (ROS)
|
Metabolic Disease
|
Corza6 is a potent and selective human voltage-gated proton channel (hHv1) peptide inhibitor. Corza6 binds to the external voltage sensor domain (VSD) loop in hHv1 with a Kd of ~1 nM at the natural, hyperpolarized resting membrane potential (RMP) of mammalian cells. Corza6 allows capacitation in sperm and permits sustained reactive oxygen species (ROS) production in white blood cells (WBCs) .
|
-
- HY-P3089A
-
|
Potassium Channel
|
Others
|
Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
-
- HY-W539944
-
Arg8-vasopressin acetate; AVP acetate
|
Vasopressin Receptor
Apoptosis
|
Neurological Disease
Cancer
|
Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
|
-
- HY-P10817A
-
|
Proton Pump
Reactive Oxygen Species (ROS)
|
Metabolic Disease
|
Corza6 TFA is a potent and selective human voltage-gated proton channel (hHv1) peptide inhibitor. Corza6 TFA binds to the external voltage sensor domain (VSD) loop in hHv1 with a Kd of ~1 nM at the natural, hyperpolarized resting membrane potential (RMP) of mammalian cells. Corza6 TFA allows capacitation in sperm and permits sustained reactive oxygen species (ROS) production in white blood cells (WBCs) .
|
-
- HY-P1074
-
|
Calcium Channel
|
Neurological Disease
|
SNX-482, a peptide, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect .
|
-
- HY-P1167
-
-
- HY-P3037A
-
|
Calcium Channel
|
Neurological Disease
|
Imperatoxin A TFA is a peptide toxin derived from the venom of the African scorpion Pandinus imperator. Imperatoxin A TFA is a Ca 2+-release channels/ryanodine receptors (RyRs) activator. Imperatoxin A TFA enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
-
- HY-P2289A
-
pBD-1 TFA
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
-
- HY-P1036A
-
|
Complement System
|
Others
|
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-P1221
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
-
- HY-P1871
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
-
- HY-P0090A
-
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
-
- HY-P3014
-
|
Potassium Channel
|
Others
|
Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1, Kv1.2, Kv1.3, and Kv1.6 of 31 pM, 170 pM, 86 pM,and 6000 pM, respectively .
|
-
- HY-P1078
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
-
- HY-P2150
-
|
Somatostatin Receptor
|
Neurological Disease
Inflammation/Immunology
|
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC50 values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .
|
-
- HY-P3219
-
|
Endogenous Metabolite
|
Endocrinology
|
N-Acetyloxytocin is isolated and characterized in the neurointermediate lobe of the rat pituitary (NIL) and their presence in several brain areas of the rat .
|
-
- HY-P1463A
-
Thyrocalcitonin eel TFA
|
Thyroid Hormone Receptor
|
Others
|
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis .
|
-
- HY-P2310
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities .
|
-
- HY-A0182
-
-
- HY-P0090
-
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
-
- HY-P1548A
-
Human β-CGRP TFA; CGRP-II (Human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P2491
-
|
Fluorescent Dye
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research .
|
-
- HY-P4976
-
-
- HY-P5694
-
|
HPV
Parasite
|
Infection
|
Human α-defensin 5 is an antiviral peptide. Human α-defensin 5 blocks infection of non-enveloped viruses, including AdV, HPV, and polyomaviruses (IC50: 0.6-1.25 μM for HPV16). Human α-defensin 5 can bind to the viral capsid and blocks escape of the virus from the endosome. Human α-defensin 5 increases HIV binding to the cell surface. Human α-defensin 5 also has parasiticidal activity .
|
-
- HY-P6053
-
|
Opioid Receptor
|
Neurological Disease
|
KK-103 is a precursor of leucine-enkephalin (Leu-ENK) overcomes high proteolytic instability of Leu-ENK via markedly increased plasma stability in mice that has antinociceptive effect .
|
-
- HY-P3899
-
|
Somatostatin Receptor
|
Metabolic Disease
|
[Nle8] Somatostatin (1-28) is a derivative of somatosttin (1-28) with norleucine replacing methionine in position 8. [Nle8] Somatostatin (1-28) increases the amylase release.[Nle8] Somatostatin (1-28) increases the cyclic AMP in pancreatic acini .
|
-
- HY-P5319
-
|
Others
Calcium Channel
|
Others
|
MCaE12A is a high-affinity modulator of RyR2 and increases RyR2 sensitivity to cytoplasmic calcium concentrations promoting channel opening. MCaE12A acts as an important tool for RyR2 structure-to-function studies as well as for manipulating Ca2+ homeostasis and dynamic of cardiac cell .
|
-
- HY-P1427
-
|
Potassium Channel
|
Neurological Disease
|
Guangxitoxin 1E is a potent and selective blocker of KV2.1 and KV2.2 channels. Guangxitoxin 1E inhibits KV2 with an IC50 of 1-3 nM. KV2 channels underlie delayed-rectifier potassium currents in various neurons .
|
-
- HY-P3099A
-
|
Guanylate Cyclase
|
Cancer
|
Uroguanylin (human) (TFA) is a natural ligand for the Guanylyl Cyclase (GCC) receptor expressed in metastatic colorectal cancer tumors. Uroguanylin (human) (TFA) has anti-tumor actions in an animal model for human colon cancer .
|
-
- HY-P5603
-
BNBD-12
|
Bacterial
|
Infection
|
Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus .
|
-
- HY-P1633
-
PG1
|
Bacterial
ERK
COX
NF-κB
Apoptosis
NO Synthase
Dengue Virus
|
Infection
Inflammation/Immunology
|
Protegrin-1 is an orally active antibacterial peptide. Protegrin-1 activates ERK, COX2, NFκB, inhibits Apoptosis, and NO production. Protegrin-1 has antibacterial activity against S. aureus, E. faecium, E. coli, P. aeruginosa and K. Pneumoniae, with MBC values between 10 and 20 µM. Protegrin-1 has antiviral activity against dengue NS2B-NS3. Protegrin-1 has anti-inflammatory activity. Protegrin-1 is used in the study of inflammatory diseases and infections .
|
-
- HY-P5818
-
-
- HY-P2310A
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human TFA is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human TFA exhibits broad antimicrobial and anti-leishmanial activities .
|
-
- HY-P1766
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors .
|
-
- HY-P4994
-
-
- HY-P1932A
-
-
- HY-P1463
-
Thyrocalcitonin eel
|
Thyroid Hormone Receptor
|
Endocrinology
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
-
- HY-P1078A
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
-
- HY-P5114
-
|
Calcium Channel
|
Others
|
Maurocalcine is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine can be applied to in vivo cell tracking or other cell imaging techniques .
|
-
- HY-P5631
-
|
Bacterial
|
Infection
|
Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils .
|
-
- HY-P1274
-
|
Potassium Channel
|
Inflammation/Immunology
|
ShK-Dap22 is a potent Kv1.3-specific immunosuppressive Polypeptide. ShK-Dap22 is a selective Kv1.3 channel blocker with IC50s of 23 pM, 1.8 nM, 10.5 nM, 37 nM, and 39 nM for mKv1.3, mKv1.1, hKv1.6, mKv1.4, and rKv1.2 channels, respectively .
|
-
- HY-12554B
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
-
- HY-P10758
-
-
- HY-P3656
-
|
Potassium Channel
|
Inflammation/Immunology
|
Kaliotoxin (1-37) is a toxin from the scorpion Artdroctonus mauretanicus mauretanicus. Kaliotoxin (1-37) is a potent calcium-dependent potassium channel blocker .
|
-
- HY-P5786
-
-
- HY-P5925
-
SsTx Toxin
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Ssm Spooky Toxin is found in Scolopendra mutilans that potently inhibits KCNQ (voltage-gated potassium channel family 7) channels, with IC50s of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin plays an essential role in the centipede’s circulatory system .
|
-
- HY-P5797
-
-
- HY-P10685
-
[Tyr5,12,Lys7]-Polyphemusin II
|
HIV
CMV
|
Infection
|
T-22 (polyphemusin II with [Tyr5,12,Lys7]) is a new synthetic peptide that fights HIV, with an EC50 of 0.008 μg/mL and a CC50 of 54 μg/mL. T22 promotes plant height, photosynthesis, total chlorophyll content, and gas exchange in tomatoes, and it can resist CMV .
|
-
- HY-P1403
-
|
Potassium Channel
|
Others
|
Tertiapin LQ is a specific and reversible renal outer medullary potassium ROMK1 (Kir1.1) channel inhibitor .
|
-
- HY-P10684
-
|
Bacterial
|
Infection
|
Polyphemusin II is an antimicrobial peptide which can be isolated from Limulus polyphemus hemocytes. Polyphemusin II exhibits antimicrobial activities against various Gram (+)/(-) bacteria and fungi .
|
-
- HY-P10869
-
|
Natriuretic Peptide Receptor (NPR)
|
Inflammation/Immunology
Cancer
|
dCNP binds to NPR-B/C receptor, activates cGMP signaling pathway, and regulates vascular function. dCNP exhibits anti-hypoxia property through downregulation of hypoxia-related genes expressions like HIF1α and HIF2α. dCNP inhibits the induction of tumor stroma and exhibits anti-fibrosis activity. dCNP upregulates CTLs, NK cells, and conventional type 1 dendritic cells in tumors, and activates immune responses .
|
-
- HY-P3483
-
|
PACAP Receptor
Caspase
Apoptosis
PKA
Interleukin Related
TNF Receptor
|
Cardiovascular Disease
Neurological Disease
|
Maxadilan is a specific irreversible PAC1 receptor agonist and a potent vasodilator peptide present in the salivary glands of sand flies. Maxadilan exhibits anti-apoptotic activity in hADSCs. Maxadilan inhibits pro-inflammatory cytokines (TNF-α) and enhances anti-inflammatory mediators (IL-10). Maxadilan can activate leukocytes and inhibit vascular permeability through PAC1 receptors. Maxadilan promotes neural differentiation of human adipose-derived stem cells. Maxadilan can be used to study endotoxin shock, atherosclerosis, and neurodegenerative diseases [1] [2] [3] [4] [5].
|
-
- HY-P3512
-
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
Cancer
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
-
- HY-P5853
-
|
Potassium Channel
|
Inflammation/Immunology
|
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research .
|
-
- HY-P10654
-
-
- HY-P3901
-
|
Somatostatin Receptor
|
Neurological Disease
|
[Leu8,D-Trp22,Tyr25] Somatostatin-28 is the analog of Somatostatin-28. Somatostatin-28 is a intestinal peptide containing somatostatin in its C-terminal portion .
|
-
- HY-P0256
-
-
- HY-P5644
-
|
Bacterial
|
Infection
|
Retrocyclin-3 is an antimicrobial peptide against human immunodeficiency virus, influenza A and herpes simplex virus .
|
-
- HY-P5089
-
-
- HY-P5628
-
|
Bacterial
|
Infection
|
Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity .
|
-
- HY-P5925A
-
SsTx Toxin TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Ssm Spooky Toxin TFA is found in Scolopendra mutilans that potently inhibits KCNQ (voltage-gated potassium channel family 7) channels, with IC50s of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin TFA inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin TFA plays an essential role in the centipede’s circulatory system .
|
-
- HY-P3563
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
[Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
|
-
- HY-P0062
-
-
- HY-P1441
-
|
Sodium Channel
|
Others
|
Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation .
|
-
- HY-P5770
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V, a 29-residue polypeptide, is derived from the venom of the spider Chilobrachys jingzhao. Jingzhaotoxin-V inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 nM and 30.2 nM, respectively. Jingzhaotoxin-V also inhibits Kv4.2 potassium currents expressed in Xenpus Laevis oocytes (IC50 of 604.2 nM) .
|
-
- HY-P3384
-
|
Antibiotic
|
Others
Inflammation/Immunology
|
Pezadeftide is a potent antifungal peptide. Pezadeftide can enter fungal cells and cause a rapid mitochondrial response that results in hyperpolarization of the mitochondrial membrane .
|
-
- HY-P5816
-
|
Sodium Channel
|
Neurological Disease
|
BmK-M1 is a scorpion toxin, and is composed of 64 amino acids cross-linked by four disulfide bridges. BmK-M1 inhibits Na + channel and can be considered both as a cardiotoxin and a neurotoxin .
|
-
- HY-P4863
-
-
- HY-P1286
-
-
- HY-108741A
-
|
Guanylate Cyclase
|
Inflammation/Immunology
Cancer
|
Plecanatide acetate, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide acetate activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide acetate can be used for the research of chronic idiopathic constipation, and it also shows anti-inflammatory activity in models of murine colitis .
|
-
- HY-P5782
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1a toxin is a selective Nav1.1 activator. δ-Theraphotoxin-Hm1a toxin elicits pain and touch sensitivity. δ-Theraphotoxin-Hm1a toxin can be used for the research of irritable bowel syndrome .
|
-
- HY-P1189
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
-
- HY-P5813
-
β-TRTX-cd1a; β-Theraphotoxin-cd1a
|
Calcium Channel
|
Neurological Disease
|
Cd1a is a β-toxin derived from the African spider Ceratogyrus darlingi. Cd1a can regulate calcium ion channels. Cd1a inhibits human calcium ion channels (Cav2.2)(IC502.6 μM) and mouse sodium ion channels (Nav1.7). Cd1a can be used in the development of peripheral pain treatment drugs .
|
-
- HY-P2539
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
-
- HY-P4191
-
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P4898
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone .
|
-
- HY-P0190A
-
|
Potassium Channel
|
Others
|
Iberiotoxin (TFA) is a selective high conductance high conductance Ca 2+-activated K + channel inhibitor with a Kd of ~1 nM. Iberiotoxin (TFA) does not block other types of voltage-dependent ion channels .
|
-
- HY-P4056
-
P15-Tat
|
Casein Kinase
Apoptosis
|
Cancer
|
CIGB-300 (P15-Tat) is an anti-casein kinase 2 (CK2) peptide that exhibits anticancer properties by interfering with the phosphorylation of protein kinase CK2. CIGB-300 induces apoptosis in multiple tumor cell lines and can be used in cancer research .
|
-
- HY-125053A
-
|
Glycoprotein VI
|
Cardiovascular Disease
|
Batifiban TFA, a cyclic peptide, is an antagonist of platelet glycoprotein GPⅡb/Ⅲa and inhibits platelet aggregation. Batifiban blocks the binding of circulating vitronectin to integrin ανβ3 .
|
-
- HY-P2699
-
GrTx; ω-GsTx SIA
|
Calcium Channel
|
Neurological Disease
|
ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases .
|
-
- HY-P4928
-
|
Amylin Receptor
|
Metabolic Disease
|
Biotinyl-Amylin (mouse, rat) is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
-
- HY-P1424A
-
|
Potassium Channel
|
Neurological Disease
|
Lei-Dab7 TFA is a high affinity, selective KCa2.2 (SK2) channel blocker (Kd=3.8 nM). Lei-Dab7 TFA exhibits >200-fold selectivity for KCa2.2 over KCa2.1, KCa2.3, KCa3.1, Kv and Kir2.1. Lei-Dab7 TFA increases theta-burst responses and increases LTP in rat hippocampal slices in vitro.
|
-
- HY-P1441A
-
|
Sodium Channel
|
Neurological Disease
|
Mambalgin 1 TFA is a selective ASIC1a inhibitor (IC50 values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Mambalgin 1 TFA binds to closed/inactive channel. Mambalgin 1 TFA is selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Mambalgin 1 TFA increases latency of withdrawal response in mouse tail-flick and paw-flick tests.
|
-
- HY-P0207
-
Endothelin-2 (human, canine); Human endothelin-2
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
-
- HY-P5784
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 17nM. δ-Buthitoxin-Hj1a can be used for the Dravet syndrome (DS) research .
|
-
- HY-P4971
-
|
Complement System
|
Inflammation/Immunology
|
C5a Anaphylatoxin (human) is a pro-inflammatory peptide and a leukocyte chemoattractant. C5a Anaphylatoxin (human) can be used to study inflammation and immunity, such as allergic asthma .
|
-
- HY-P2707
-
α-DTX
|
Sodium Channel
Potassium Channel
|
Others
|
α-Dendrotoxin (α-DTX) is a small molecule peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). α-Dendrotoxin is also a KV1.1, KV1.2, KV1.6 and ASIC channel blocker. α-Dendrotoxin blocks potassium channels, lowers the threshold of neuronal action potentials, and increases the frequency of action potentials, thereby enhancing neuronal excitability. α-Dendrotoxin can be used in neurotoxicology research .
|
-
- HY-P5798
-
FAS-I
|
Cholinesterase (ChE)
|
Neurological Disease
|
Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes .
|
-
- HY-P5796
-
|
Calcium Channel
|
Neurological Disease
|
FS-2 is a potent and specific L-type CaV channel inhibitor. FS-2 inhibits high K + or glucose induced L-type Ca 2+ influx in RIN beta cells .
|
-
- HY-P5785A
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2 (TFA), a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
-
- HY-P5806
-
ErgTx1
|
Potassium Channel
|
Neurological Disease
|
Ergtoxin-1 is a potassium channel blocker.
Ergtoxin-1 is isolated from the venom of the Mexican scorpion
Centruroides noxius. Ergtoxin 1 can block
ERG-K + channels in nerve, heart and endocrine cells .
|
-
- HY-P5771
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .
|
-
- HY-P4898A
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A TFA is a soidum channel toxin. Anthopleurin-A TFA is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A TFA can be isolated from the sea anemone .
|
-
- HY-P5887
-
-
- HY-P5810
-
CcoTx2; β-TRTX-cm1b
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav1.3/β1, respectively .
|
-
- HY-P0204
-
-
- HY-P1189A
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
-
- HY-P4928A
-
|
Amylin Receptor
|
Metabolic Disease
|
Biotinyl-Amylin (mouse, rat) TFA is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
-
- HY-P1080A
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA TFA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA TFA has no effect on L-type or N-type calcium channels .
|
-
- HY-P3277
-
|
Ras
|
Cancer
|
KRpep-2d is a potent K-Ras inhibitor and inhibits proliferation of K-Ras-driven cancer cells. KRpep-2d can be used for cancer research .
|
-
- HY-P3448
-
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
-
- HY-P5870
-
|
Potassium Channel
|
Inflammation/Immunology
|
KTX-Sp2 is a potassium channel toxin. KTX-Sp2 effectively blocks three types of exogenous voltage-gated potassium channels: Kv1.1, Kv1.2 and Kv1.3. Ktx-Sp2 inhibits endogenous Kv1.3 and suppresses Ca 2+ signaling in Jurkat T cells. Ktx-Sp2 inhibits IL-2 secretion from activated Jurkat T cells .
|
-
- HY-P4869
-
|
Ras
|
Others
|
Biotin-KRpep-2d acetate is a biotin-labeled KRpep-2d (HY-P3277) .
|
-
- HY-P2949
-
|
Potassium Channel
|
Cancer
|
Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel .
|
-
- HY-P1079
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin TK, a peptidyl toxin of the venom of Agelenopsis aperta, is a potent and selective P/Q type Ca 2+ channel blocker. ω-Agatoxin TK inhibits the high K + depolarisation-induced rise in internal Ca 2+ in cerebral isolated nerve endings with an IC50 of of 60 nM. ω-Agatoxin TK has no effect on L-type, N-type, or T-type calcium channels .
|
-
- HY-P4191A
-
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P1218B
-
|
Sodium Channel
|
Neurological Disease
|
Phrixotoxin 3-NH2 TFA is a derivative of Phrixotoxin 3 TFA (HY-P1218A). Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
-
- HY-P0202A
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P4056A
-
P15-Tat acetate
|
Casein Kinase
Apoptosis
|
Cancer
|
CIGB-300 acetate (P15-Tat acetate) is an anti-casein kinase 2 (CK2) peptide that exhibits anticancer properties by interfering with the phosphorylation of protein kinase CK2. CIGB-300 acetate induces apoptosis in multiple tumor cell lines and can be used in cancer research .
|
-
- HY-P1281
-
|
Potassium Channel
|
Neurological Disease
|
Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability .
|
-
- HY-P5809
-
-
- HY-P5788
-
|
Potassium Channel
|
Neurological Disease
|
Hemitoxin, a scorpion-venom peptide, is a K + channel blocker. Hemitoxin blocks rat Kv1.1, Kv1.2 and Kv1.3 channels expressed in Xenopus oocytes with IC50 values of 13 nM, 16 nM and 2 nM, respectively .
|
-
- HY-P3433
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
-
- HY-17571F
-
Biotin-α-Hypophamine; Biotin-Oxytocic hormone
|
Oxytocin Receptor
|
Others
|
Biotin-Oxytocin (Biotin-α-Hypophamine; Biotin-Oxytocic hormone) is a biological active peptide. (This is Oxytocin (HY-17571) N-terminally labeled with Biotin.)
|
-
- HY-P0190
-
|
Potassium Channel
|
Cardiovascular Disease
|
Iberiotoxin is a toxin isolated from Buthus tamulus scorpion venom. Iberiotoxin is a selective high conductance high conductance Ca 2+-activated K + channel inhibitor with a Kd of ~1 nM. Iberiotoxin does not block other types of voltage-dependent ion channels .
|
-
- HY-P5077A
-
|
Guanylate Cyclase
|
Metabolic Disease
|
Guanylin (mouse, rat) TFA, a petide, is composed of 15 amino acids. Guanylin (mouse, rat) TFA is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) TFA can be used for the research of diarrhea .
|
-
- HY-P5914A
-
WaTx TFA
|
TRP Channel
|
Neurological Disease
|
Wasabi Receptor Toxin TFA (WaTx TFA) is the TFA salt form of Wasabi Receptor Toxin (HY-P5914). Wasabi Receptor Toxin TFA is a cell-penetrating scorpion toxin. Wasabi Receptor Toxin TFA is the activator for TRPA1 ion channel with EC50 in nanomolar level, and prolongs the channel open time, but reduces Ca 2+ permeability. Wasabi Receptor Toxin TFA causes thermal hypersensitivity and mechanical allodynia in rats, without triggering neurogenic inflammation .
|
-
- HY-P5851
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaHI can be used as a tool for the development of active substances with toxin-neutralizing capabilities .
|
-
- HY-P5130
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic response in conscious Sprague-Dawley rats. Big endothelin-1 (rat 1-39) raises blood pressure in mice .
|
-
- HY-P5643
-
|
Bacterial
|
Infection
|
Retrocyclin-2 is an antimicrobial peptide against human immunodeficiency virus, influenza A and herpes simplex virus .
|
-
- HY-P4066
-
|
Interleukin Related
|
Cancer
|
Emfilermin is a recombinant human leukaemia inhibitory factor (LIF) that can be used in chemotherapy-induced peripheral neuropathy studies .
|
-
- HY-P10383
-
|
NO Synthase
|
Infection
|
SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
-
- HY-P0017
-
-
- HY-P2222
-
-
- HY-P0062A
-
-
- HY-P5873
-
JZTX-X
|
Potassium Channel
|
Neurological Disease
|
Jingzhaotoxin-X (JZTX-X) is a selective Kv4.2 and Kv4.3 potassium channels inhibitor. Jingzhaotoxin-X causes long-lasting mechanical hyperalgesia .
|
-
- HY-P10383A
-
|
NO Synthase
|
Infection
|
SPSB2-iNOS inhibitory cyclic peptide-1 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-1(HY-P10383). SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
-
- HY-P0062B
-
-
- HY-P0256A
-
Apamine TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Apamin TFA (Apamine TFA) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
-
- HY-P10851
-
|
Apoptosis
|
Inflammation/Immunology
Cancer
|
HVEM(14-39) is a B- and T-lymphocyte attenuator (BTLA) peptide inhibitor. HVEM (14-39) can be combined with BTLA with a KD of 0.102 μM. HVEM(14-39) enhances the activation and proliferation of T cells by regulating the expression of BTLA and HVEM in T cells, and promotes the transformation of cells into effector memory T cells. HVEM(14-39) inhibits tumor cell proliferation and promotes late apoptosis. HVEM(14-39) has immunomodulatory effects and can be used in the study of cancer .
|
-
- HY-P3655
-
|
Calcium Channel
|
Others
|
Agelenin is a polypeptide composed of 35 amino acids. Agelenin could be isolated from the Agelenidae spider Agelena opulenta. Agelenin has structural similarity to insect-specific calcium channel inhibitor .
|
-
- HY-P2710
-
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC50 = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease .
|
-
- HY-P5785
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
-
- HY-P1286A
-
-
- HY-P5089A
-
-
- HY-P2222A
-
-
- HY-P0202
-
-
- HY-P1220
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P5863
-
Mamb-2
|
Sodium Channel
|
Neurological Disease
|
Mambalgin-2 (Mamb-2) is an acid-sensitive ion channels (ASICs) inhibitor and a venom peptide. Mambalgin-2 can be obtained from the venom of the African black mamba. Mambalgin-2 can be used in the study of pain and neurological diseases .
|
-
- HY-P5811
-
CcoTx1; β-TRTX-cm1a
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1 .
|
-
- HY-P3903
-
|
Somatostatin Receptor
|
Endocrinology
|
[D-Trp8,Tyr11] Somatostatin is an analogue of somatostatin. Somatostatin is a hormone that regulates a variety of bodily functions. DTrp8 residue can increase stability .
|
-
- HY-125053
-
|
Integrin
|
Cardiovascular Disease
|
Batifiban, a cyclic peptide, is a platelet glycoprotein GPⅡb/Ⅲa antagonist, and inhibits platelet aggregation. Batifiban blocks circulating vitronectin binding to integrin ανβ3, Batifiban can be used for research of acute coronary syndromes .
|
-
- HY-P3571
-
|
Endothelin Receptor
|
Cancer
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
-
- HY-P3732
-
|
Integrin
|
Cancer
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
|
-
- HY-P1220A
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P3902
-
-
- HY-P5914
-
WaTx
|
TRP Channel
|
Neurological Disease
|
Wasabi Receptor Toxin is a cell-penetrating scorpion toxin. Wasabi Receptor Toxin is the activator for TRPA1 ion channel with EC50 in nanomolar level, and prolongs the channel open time, but reduces Ca 2+ permeability. Wasabi Receptor Toxin causes thermal hypersensitivity and mechanical allodynia in rats, without triggering neurogenic inflammation .
|
-
- HY-108741
-
|
Guanylate Cyclase
|
Inflammation/Immunology
Cancer
|
Plecanatide, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide shows anti-inflammatory activity in models of murine colitis .
|
-
- HY-P5793
-
-
- HY-P5736
-
|
Bacterial
|
Infection
|
Bass hepcidin is an antimicrobial activity against Escherichia coli. .
|
-
- HY-P10328
-
|
DNA/RNA Synthesis
|
Metabolic Disease
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
-
- HY-P2538
-
-
- HY-P3711
-
|
Na+/K+ ATPase
|
Others
|
SPAI-1 is a specific inhibitor for monovalent cation transporting ATPases. SPAI-1 is a peptide isolated from porcine duodenum, inhibits Na +, K +-ATPase and H +, K +-ATPase in vitro, stimulates Mg 2+-ATPase .
|
-
- HY-P1080
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA has no effect on L-type or N-type calcium channels .
|
-
- HY-P5795
-
|
Sodium Channel
Potassium Channel
|
Neurological Disease
|
GsAF-I is a potent Nav and hERG1 channels blocker with IC50s of 0.36, 0.6, 1.28, 0.33, 1.2, 0.04 and 4.8 μM against Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, Nav1.7 and hERG1, respectively .
|
-
- HY-P3277A
-
|
Ras
|
Cancer
|
KRpep-2d (TFA) is a potent K-Ras inhibitor and inhibits proliferation of K-Ras-driven cancer cells. KRpep-2d can be used for cancer research .
|
-
- HY-P5077
-
|
Guanylate Cyclase
|
Metabolic Disease
|
Guanylin (mouse, rat), a petide, is composed of 15 amino acids. Guanylin (mouse, rat) is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) can be used for the research of diarrhea .
|
-
- HY-102029
-
SRTX-c
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6c (SRTX-c) is a potent endothelin-B receptor agonist. Sarafotoxin S6c can cause vasoconstriction in both endothelium-intact and endothelium-denuded vessels .
|
-
- HY-P0204A
-
-
- HY-P3565
-
STX-b
|
Calcium Channel
|
Cardiovascular Disease
|
Sarafotoxin S6d (STX-b) is a polypeptide toxin isolated from the venom of the Israeli sand boa constrictor. Sarafotoxin S6d induces multiple electrocardiogram (ECG) changes including myocardial ischemia and hyperkalemia. Sarafotoxin S6d induces strong extracellular calcium-dependent vasoconstriction in rat aorta and exhibits positive inotropic effects in rat atria. Sarafotoxin S6d can be used in the study of cardiovascular diseases .
|
-
- HY-P5651
-
|
Bacterial
|
Infection
|
PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Candida albicans .
|
-
- HY-P0207A
-
Endothelin-2 (49-69) (human, canine) TFA; Human endothelin-2 TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
Endothelin-2 (49-69), human (TFA) (Endothelin-2 (49-69) (human, canine) (TFA)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
-
- HY-P10272
-
PTG-300
|
Ferroportin
|
Others
|
Rusfertide is a peptide mimetic of natural hepcidin, which targets and degrades ferroportin, reduces serum iron and transferrin-saturation, and thus regulates the production of red blood cells. Rusfertide ameliorates the polycythemia vera, β-thalassemia and hereditary hemochromatosis .
|
-
- HY-P2331
-
Antibiotic A 3802-IV-3; Gardimycin
|
Antibiotic
|
Infection
|
Actagardin is a tetracyclic lantibiotic produced by several species of Actinoplanes. It is composed of macrocyclic rings formed by thioether bridges. Actagardin preferably targets Gram-positive bacteria, inhibiting the synthesis of peptidoglycan.
|
-
- HY-P10429
-
|
CXCR
|
Infection
|
RCP168 is a highly selective and affinity CXCR4 receptor antagonist (IC50=5 nM). RCP168 has a stronger ability than natural chemical factors to inhibit the entry of HIV-1 (human immunodeficiency virus type 1) into host cells via CXCR4 receptors. RCP168 inhibits HIV-1 infection by blocking viral binding sites or inducing receptor internalization. RCP168 can be used to analyze the interaction between CXCR4 receptor and other chemical factor receptors .
|
-
- HY-P5899
-
-
- HY-P5630
-
|
Bacterial
|
Infection
|
Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria .
|
-
- HY-P4678
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
- HY-P5159
-
|
Sodium Channel
|
Inflammation/Immunology
|
Crotamine is a Na + channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom .
|
-
- HY-12537
-
-
- HY-P3204
-
POT-4
1 Publications Verification
AL-78898A
|
Complement System
|
Metabolic Disease
|
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
|
-
- HY-P5648
-
|
Bacterial
|
Infection
|
PhD2 is an antimicrobial peptide derived from monkey white blood cells. PhD2 has activity against bacteria and fungus Candida albicans .
|
-
- HY-P5738
-
|
Bacterial
|
Infection
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
-
- HY-P0083
-
POR-8
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Ornipressin (POR-8) is a vasopressin agonist specific for the V1 receptor. Ornipressin can be used as a local vasoconstrictor. Ornipressin can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin has antidiuretic activity. Ornipressin decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
-
- HY-P3269
-
|
Calcium Channel
|
Others
|
Calciseptine, a natural?neurotoxin?isolated from the black mamba Dendroaspis p. polylepis venom. Calciseptine consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type?calcium channel[1].
|
-
- HY-P1681A
-
|
Sodium Channel
|
Neurological Disease
|
GpTx-1 TFA is a peptide-based NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. GpTx-1 TFA demonstrates potent inhibitory activity against the NaV1.7 channel with an IC50 value of 10 nM, while exhibiting excellent selectivity for NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM), showing >20-fold and >950-fold selectivity respectively .
|
-
- HY-P5943
-
-
- HY-P3220
-
|
Oxytocin Receptor
|
Endocrinology
|
[D-Asn5]-Oxytocin possesses very low specific oxytocic and vasodepressor activities. By cumulative dose-response studies for oxytocic activity, [D-Asn5]-Oxytocin has similar intrinsic activity to oxytocin .
|
-
- HY-P2313
-
HβD-2
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus . Human β-defensin-2 can be used for the study of colitis .
|
-
- HY-P5158
-
|
Adrenergic Receptor
|
Others
|
Conopeptide rho-TIA is a peptide derived from the venom contained in the predatory sea snail Conus tulipa, has highly selective and noncompetitive inhibitor at human α1B-Adrenergic Receptor. Conopeptide rho-TIA acts a competitive inhibitor at human α1A-Adrenergic Receptor and α1D-Adrenergic Receptor. Conopeptide rho-TIA binds to each subtype and may provide useful information for the development of novel α1-Adrenergic Receptor subtype-selective drugs .
|
-
- HY-P5807
-
β-Mammal toxin Cn2
|
Sodium Channel
|
Neurological Disease
|
Cn2 toxin is aβ- toxoins. Cn2 toxin can bind to the voltage
sensing domain of voltage gated sodium channels (Nav)
.
|
-
- HY-P1275
-
-
- HY-108814
-
DX-88
|
Kallikrein
|
Cardiovascular Disease
|
Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema .
|
-
- HY-P5942
-
-
- HY-P3282
-
|
Guanylate Cyclase
|
Metabolic Disease
|
MM 419447, a linaclotide metabolite, is a guanylate cyclase-C agonist. MM 419447 has the potential for the research of the irritable bowel syndrome with constipation (IBS-C) .
|
-
- HY-P1681
-
|
Sodium Channel
|
Neurological Disease
|
GpTx-1 is a peptide-based NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. GpTx-1 demonstrates potent inhibitory activity against the NaV1.7 channel with an IC50 value of 10 nM, while exhibiting excellent selectivity for NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM), showing >20-fold and >950-fold selectivity respectively .
|
-
- HY-P5871
-
JzTx-XII
|
Potassium Channel
|
Others
|
Jingzhaotoxin-XII (JzTx-XII) is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII interacts with the channels by modifying the gating behavior .
|
-
- HY-P5800
-
μ-TrTx-Phlo1b
|
Sodium Channel
|
Neurological Disease
|
Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
-
- HY-P5783
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can be used for the Dravet syndrome (DS) research .
|
-
- HY-P4370
-
|
Bacterial
Fungal
|
Infection
|
Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains .
|
-
- HY-P5846
-
MT3
|
mAChR
Adrenergic Receptor
|
Neurological Disease
|
Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D,α2A,α2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity .
|
-
- HY-P5865
-
Theraphotoxin-Tap1a; TRTX-Tap1a; µ/ω-TRTX-Tap1a
|
Sodium Channel
|
Neurological Disease
|
Tap1a (Theraphotoxin-Tap1a) is a spider venom peptide that inhibits sodium channels with IC50s of 80 nM and 301 nM against Nav1.7 and Nav1.1, respectively. Tap1a shows analgesic effects .
|
-
- HY-P5157
-
|
Potassium Channel
|
Neurological Disease
|
BmP02 is a selective Kv1.3 channel blocker and a highly-selective Kv4.2 modulator, which can be isolated from Chinese scorpion (Buthus martensi Karsch) venom. BmP02 also delays the inactivation of Kv4.2 in HEK293T cells, with an EC50 value of ~850 nM. BmP02 inhibits the transient outward potassium currents (Ito) in ventricular muscle cells .
|
-
- HY-P5649
-
|
Bacterial
|
Infection
|
PhD3 is an antimicrobial peptide derived from monkey white blood cells. PhD3 has activity against bacteria and fungus Candida albicans .
|
-
- HY-P4373
-
|
Cathepsin
MMP
|
Metabolic Disease
|
Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation .
|
-
- HY-P5625
-
|
Bacterial
|
Infection
|
ROAD-1 is an oral mucosal α-defensin of Rhesus Macaque. ROAD-1 is active against S. aureus, E. coli, and C. albicans .
|
-
- HY-P5835
-
|
Potassium Channel
|
Neurological Disease
|
δ-Dendrotoxin is a K + channel blocker that can be obtained from the venom of the black mamba snake. δ-Dendrotoxin can be used in the study of neurological diseases .
|
-
- HY-P4678A
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
- HY-P2315
-
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
-
- HY-P1166
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
UFP-803 is a potent urotensin-II receptor (UT) ligand. UFP-803 has lower residual agonist activity, so it may be an important tool for the investigations on the role played by the UT system in physiology and pathology .
|
-
- HY-P5739
-
|
Bacterial
|
Infection
|
Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family .
|
-
- HY-P5869
-
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
-
- HY-P5900
-
m3-HwTx-IV
|
Sodium Channel
|
Neurological Disease
|
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model .
|
-
- HY-P0083A
-
POR-8 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Ornipressin (POR-8) acetate is a potent vasoconstrictor, hemostatic and renal agent. Ornipressin acetate is a vasopressin agonist specific for the V1 receptor. Ornipressin acetate can be used as a local vasoconstrictor. Ornipressin acetate can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin acetate has antidiuretic activity. Ornipressin acetate decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
-
- HY-P1166A
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
UFP-803 TFA is a potent urotensin-II receptor (UT) ligand. UFP-803 TFA has lower residual agonist activity, so it may be an important tool for the investigations on the role played by the UT system in physiology and pathology .
|
-
- HY-P5159A
-
|
Sodium Channel
|
Inflammation/Immunology
|
Crotamine TFA is a Na + channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom .
|
-
- HY-P5142
-
ω-ACTX-Hv1; ω-Atracotoxin-HV1
|
Calcium Channel
|
Neurological Disease
|
ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a blocks voltage-gated calcium channels .
|
-
- HY-108814A
-
DX-88 TFA
|
Kallikrein
|
Cardiovascular Disease
|
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema .
|
-
- HY-P5801
-
μ-TrTx-Phlo1a
|
Sodium Channel
|
Neurological Disease
|
Phlo1a (μ-TrTx-Phlo1a) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1a has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
-
- HY-P5871A
-
JzTx-XII TFA
|
Potassium Channel
|
Others
|
Jingzhaotoxin-XII (JzTx-XII) TFA is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII TFA interacts with the channels by modifying the gating behavior .
|
-
- HY-P4373A
-
|
Cathepsin
MMP
|
Inflammation/Immunology
|
Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA facilitates osteoclast differentiation .
|
-
- HY-P4010
-
|
Vasopressin Receptor
|
Others
|
Desamino(D-3-(3′-pyridyl)-Ala2,Arg8)-Vasopressin, a synthetic analog of vasopressin (AVP), is a weak agonist at antidiuretic receptor. However, Desamino(D-3-(3′-pyridyl)-Ala2,Arg8)-Vasopressin is a potent agonist at pituitary corticotrope receptor .
|
-
- HY-P5156
-
|
Potassium Channel
|
Neurological Disease
|
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death .
|
-
- HY-P5807A
-
β-Mammal toxin Cn2 TFA
|
Sodium Channel
|
Neurological Disease
|
Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6 .
|
-
- HY-P5872
-
JZTX-XI
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin XI (JZTX-XI) is a sodium conductance inhibitor with an IC50 of 124 nM. Jingzhaotoxin XI slows the fast inactivation (EC50=1.18±0.2 μM) of Nav1.5 expressed in Chinese hamster ovary (CHO-K1) cells .
|
-
- HY-P0173A
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
-
- HY-P5860
-
Micrurotoxin 1
|
GABA Receptor
|
Neurological Disease
|
MmTx1 toxin (Micrurotoxin 1) is an allosteric GABAA receptor modulator that increases GABAA receptor susceptibility to agonist .
|
-
- HY-P5160A
-
PhlTx1 TFA
|
Sodium Channel
|
Neurological Disease
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
-
- HY-P1604A
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II TFA is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II TFA causes delayed inactivation of the Na +
|
-
- HY-P1411A
-
PcTx1 TFA; Psalmopoeus cambridgei toxin-1 TFA
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
Psalmotoxin 1 (PcTx1) TFA is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 TFA is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 TFA can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 TFA can be used in the research of cancers, or neurological disease .
|
-
- HY-P1409
-
|
Potassium Channel
|
Inflammation/Immunology
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-P5177
-
-
- HY-P2496
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P1139
-
PCFWKTCK
|
GHSR
|
Metabolic Disease
|
Cortistatin-8 (CST-8; PCFWKTCK), a neuropeptide, is a GHS-R1a antagonist by counteracting the response of ghrelin on gastric acid secretion. Cortistatin-8 can modulate GH release from somatotroph cells. Cortistatin-8 is a synthetic CST-analogue devoid of any binding affinity to SST-R but capable to bind the GHS-R1a. Cortistatin-8 can exert antagonistic effects on ghrelin actions either in vitro or in vivo in animals .
|
-
- HY-P5921
-
TsTx-Kα
|
Potassium Channel
|
Neurological Disease
|
Tityustoxin-Kα (TsTx-Kα) is an inhibitor of potassium voltage-gated channels. Tityustoxin-Kα shows a dose-dependent block of the sustained outward current in cultured hippocampal neurons .
|
-
- HY-P2031
-
|
Arp2/3 Complex
|
Others
|
Phallacidin is a member of the phallotoxin family of mushroom toxins. Phallacidin binds F-actin .
|
-
- HY-P5179
-
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
-
- HY-P1216A
-
|
Melanocortin Receptor
|
Neurological Disease
|
HS014 TFA is a potent and selective melanocortin-4 (MC4) receptor antagonist, with Kis of 3.16, 108, 54.4 and 694 nM for human MC4, MC1, MC3 and MC5 receptors respectively. HS014 TFA increases food intake in free-feeding rats .
|
-
- HY-P3111
-
|
Potassium Channel
|
Others
|
Slotoxin, a peptide from Centruroides noxius Hoffmann scorpion venom, blocks high conductance calcium-activated potassium channel, with Kd of 1.5 nM[1].
|
-
- HY-19870
-
-
- HY-P1411
-
PcTx1; Psalmopoeus cambridgei toxin-1
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease .
|
-
- HY-P1264
-
|
nAChR
|
Neurological Disease
|
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM .
|
-
- HY-P3065
-
|
Calcium Channel
|
Neurological Disease
|
Calcicludine is a protein toxin from the venom of the green mamba that inhibits high-voltage-activated calcium channel, especially L-type calcium channel .
|
-
- HY-P1216
-
|
Melanocortin Receptor
|
Neurological Disease
|
HS014 is a potent and selective melanocortin-4 (MC4) receptor antagonist, with Kis of 3.16, 108, 54.4 and 694 nM for human MC4, MC1, MC3 and MC5 receptors, respectively. HS014 modulates the behavioral effects of morphine in mice. HS014 increases food intake in free-feeding rats .
|
-
- HY-P1424
-
|
Potassium Channel
|
Neurological Disease
|
Lei-Dab7 is a potent and selective SK2 (KCa2.2) channels blocker with a Kd of 3.8 nM. Lei-Dab7 shows low or no activity on KCa1, KCa3, Kv and Kir2.1 channels .
|
-
- HY-P5160
-
PhlTx1
|
Sodium Channel
|
Neurological Disease
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
-
- HY-P5183
-
|
Sodium Channel
|
Neurological Disease
|
Hm1a is a disulfide-rich spider-venom peptide, and a NaV1.1 activator. Hm1a restores the function of inhibitory interneurons in Dravet syndrome (DS) mouse model .
|
-
- HY-P3071
-
Stichodactyla helianthus neurotoxin
|
Potassium Channel
|
Inflammation/Immunology
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
-
- HY-106224
-
Hypocretin-1 (human, rat, mouse)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)), a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A (human, rat, mouse) has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
-
- HY-P0173B
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker . Anti-cancer activity .
|
-
- HY-P5868
-
|
Sodium Channel
|
Neurological Disease
|
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages .
|
-
- HY-P1219
-
β-TRTX-Cj1α
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-III is a potent and selective blocker of Nav1.5 channels, with an IC50 of 348 nM, and shows no effect on other sodium channel isoforms. Jingzhaotoxin-III can selectively inhibit the activation of cardiac sodium channel but not neuronal subtypes, and hopefully represents an important ligand for discriminating cardiac VGSC subtype .
|
-
- HY-P1604
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na +
|
-
- HY-106224A
-
Hypocretin-1 (human, rat, mouse) (TFA)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)) TFA, a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) TFA binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A (human, rat, mouse) TFA has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) TFA is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
-
- HY-P3213
-
-
- HY-P1410
-
GsMTx4
Maximum Cited Publications
70 Publications Verification
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
-
- HY-P5010
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
-
- HY-P1390
-
|
Vasopressin Receptor
|
Endocrinology
|
d[Cha4]-AVP is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
-
- HY-P5854
-
|
Potassium Channel
|
Neurological Disease
|
Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases .
|
-
- HY-P5857
-
Micrurotoxin 2
|
GABA Receptor
|
Neurological Disease
|
MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain .
|
-
- HY-P10924
-
|
Elastase
|
Metabolic Disease
|
Roseltide rT1 is a neutrophil elastase inhibitor (IC50=0.47 μM) rich in cysteine and one of the Roseltide (rT1-rT8) family members. Roseltide rT1 improves cAMP accumulation stimulated by neutrophil elastase in vitro, showing potential for inhibiting related diseases .
|
-
- HY-P5681
-
|
Bacterial
|
Infection
Inflammation/Immunology
|
Human α-Defensin 6, a 32-residue cysteine-rich peptide, can inhibit bacterial invasion and contribute to the mucosal immunity. Human α-Defensin 6 forms ordered self-assembly fibrils and nanonets that surround and entangle bacteria after stochastic binding to bacterial surface proteins. Human α-Defensin 6 also inhibits C. albicans biofilm formation .
|
-
- HY-P3462
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .
|
-
- HY-P3479
-
-
- HY-106224B
-
Hypocretin-1 (human, rat, mouse) acetate
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (Hypocretin-1) (human, rat, mouse) acetate is a hypothalamic neuropeptide with analgesic properties (crosses the blood-brain barrier). Orexin A (human, rat, mouse) acetate binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A (human, rat, mouse) acetate can be used in studies of appetite regulation, neurodegenerative diseases and modulation of injurious messaging .
|
-
- HY-P5164
-
|
Sodium Channel
|
Neurological Disease
|
GrTx1 is a peptide toxin originally isolated from the venom of the spider Grammostola rosea. GrTx1 blocks sodium channel, with IC50s of 0.63 μM, 0.23 μM, 0.77 μM, 1.29 μM, 0.63 μM and 0.37 μM for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7, repectively . GrTx1 can be used for neurological disease research .
|
-
- HY-P2656
-
hBD-4
|
Bacterial
|
Infection
|
β-Defensin-4 human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity .
|
-
- HY-P3462A
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .
|
-
- HY-103277A
-
|
Bombesin Receptor
|
Neurological Disease
Metabolic Disease
|
BIM 23042 TFA, a certain somatostatin (SS) octapeptide analogue, is a selective neuropeptide neuromedin B receptor (NMB-R, BB1) antagonist. BIM 23042 has 100-fold lower affinity for gastrin-releasing peptide (GRP) receptor (BB2). BIM 23042 inhibits Neuromedin B (HY-P0241), ICI 216140 and DPDM-bombesin ethylamide-induced Ca 2+ release .
|
-
- HY-P1410A
-
GsMTx4 TFA
Maximum Cited Publications
70 Publications Verification
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
GsMTx4 TFA is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 TFA also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 TFA is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
-
- HY-P1409A
-
|
Potassium Channel
|
Inflammation/Immunology
|
ADWX 1 TFA is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 TFA ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 TFA can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-103277
-
|
Bombesin Receptor
|
Neurological Disease
Metabolic Disease
|
BIM 23042, a certain somatostatin (SS) octapeptide analogue, is a selective neuropeptide neuromedin B receptor (NMB-R, BB1) antagonist. BIM 23042 has 100-fold lower affinity for gastrin-releasing peptide (GRP) receptor (BB2). BIM 23042 inhibits Neuromedin B (HY-P0241), ICI 216140 and DPDM-bombesin ethylamide-induced Ca 2+ release .
|
-
- HY-P0090S
-
Salmon calcitonin-13C6,15N4 TFA
|
CGRP Receptor
|
Metabolic Disease
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
-
- HY-17584A
-
|
Guanylate Cyclase
|
Cancer
|
Linaclotide acetate is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation.
|
-
- HY-P5916
-
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
|
Others
Potassium Channel
|
Neurological Disease
|
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
|
-
- HY-P1108A
-
|
CFTR
|
Others
|
Astressin 2B TFA is a potent and selective corticotropin-releasing factor receptor 2 (CRF2) antagonist, with the IC50 values of 1.3 nM and > 500 nM for CRF2 and CRF1, respectively. Astressin 2B TFA antagonizes CRF2-mediated inhibition of gastric emptying .
|
-
- HY-P1108
-
|
CFTR
|
Others
|
Astressin 2B is a potent and selective corticotropin-releasing factor receptor 2 (CRF2) antagonist, with the IC50 values of 1.3 nM and > 500 nM for CRF2 and CRF1, respectively. Astressin 2B antagonizes CRF2-mediated inhibition of gastric emptying .
|
-
- HY-P1329
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP is a potent and highly selective μ-opioid receptor antagonist. CTOP antagonizes the acute morphine-induced analgesic effect and hypermotility. CTOP enhances extracellular dopamine levels in the nucleus accumbens. CTOP dose-dependently enhances locomotor activity .
|
-
- HY-P5154
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P3350
-
|
Bacterial
|
Infection
|
LS-BF1 is a stable and low toxic cationic antimicrobial peptide. LS-BF1 displays broad spectrum of antibacterial activity, including the challenging ESKAPE pathogens, by cell membrane disruptive mechanism. LS-BF1 shows good in vivo efficacy for elimination of bacteria in a mouse infection model[1].
|
-
- HY-P5172
-
|
Sodium Channel
|
Neurological Disease
|
MitTx-alpha is a subunit of MitTx. MitTx is a potent, persistent, and selective agonist for acid-sensing ion channels (ASICs). MitTx is highly selective for the ASIC1 subtype at neutral pH; under more acidic conditions (pH<6.5), MitTx massively potentiates (>100-fold) proton-evoked activation of ASIC2a channels .
|
-
- HY-P10239
-
|
Somatostatin Receptor
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
Tyr3-Octreotate is a somatostatin analog. Tyr3-Octreotate exhibits high uptake into tumor, that is capable to be labeled with radioactive metal and thus exhibits antitumor efficacy. Tyr3-Octreotate can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
-
- HY-P5184
-
HNTX-IV
|
Sodium Channel
|
Neurological Disease
|
Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif .
|
-
- HY-P10837
-
|
LAG-3
|
Inflammation/Immunology
Cancer
|
LAG-3 cyclic peptide inhibitor 12 (Cyclic peptide 12) is an inhibitor of LAG-3 with an IC50 value of 4.45 μM and a Ki value of 2.66 µM .
|
-
- HY-P2785A
-
-
- HY-P1410B
-
-
- HY-P2588
-
-
- HY-P5154A
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P5459
-
|
Bacterial
Elastase
|
Infection
|
Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3 in lung. Elafin is antibiotic against Pseudomonas aeruginosa and Staphylococcus aureus .
|
-
- HY-P3494
-
|
Endogenous Metabolite
|
Metabolic Disease
|
Hepcidin-25 (human) is an iron metabolism modulator. Hepcidin-25 (human) shows anti-inflammatory and anti-bacterial activity via modulation of iron-mediated oxidant injury .
|
-
- HY-P0028
-
|
Fluorescent Dye
|
Others
|
Phalloidin is a mushroom-derived toxin which can be used to label F-actin of the cytoskeleton with fluorochrome
.
|
-
- HY-P1410C
-
|
Piezo Channel
Calcium Channel
mTOR
PI3K
Akt
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
D-GsMTx4 TFA is a spider peptide and the D enantiomer of GsMTx4 (HY-P1410). D-GsMTx4 TFA inhibits the mechanosensitive ion channel Piezo2. D-GsMTx4 TFA inhibits [Ca 2+]i elevation. D-GsMTx4 TFA inhibits mTOR and PI3K-Akt signaling pathways. D-GsMTx4 TFA inhibits mechanical allodynia and thermal hyperalgesia. D-GsMTx4 TFA can be used in researches of mechanical stress, chronic pain and idiopathic pulmonary fibrosis .
|
-
- HY-P1695
-
Ro 09-0198
|
Antibiotic
Bacterial
|
Infection
|
Cinnamycin (Ro 09-0198) is a tetracyclic peptide antibiotic that binds specifically to phosphatidylethanolamine (PE) .
|
-
- HY-P2786A
-
-
- HY-P1426
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K + current (Ki: 131 nM) .
|
-
- HY-P5180
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
-
- HY-P3507
-
ShK-186
|
Potassium Channel
|
Metabolic Disease
Inflammation/Immunology
|
Dalazatide (ShK-186) is a specific Kv1.3 potassium channel peptide inhibitor. Dalazatide can be used in the study of autoimmune diseases such as multiple sclerosis (MS), lupus erythematosus, psoriasis, rheumatoid arthritis, type 1 diabetes and inflammatory bowel disease .
|
-
- HY-106244A
-
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
DOTATATE acetate is a DOTA-conjugated peptide. DOTATATE acetate can be labelled with radionuclides for positron emission tomography (PET) imaging and peptide receptor radionuclide research (PRRT) . DOTATATE (acetate) can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
-
- HY-106244
-
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
DOTATATE is a DOTA-conjugated peptide. DOTATATE can be labelled with radionuclides for positron emission tomography (PET) imaging and peptide receptor radionuclide research (PRRT) . DOTATATE can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
-
- HY-P0191
-
-
- HY-P3546
-
-
- HY-P10239A
-
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
Tyr3-Octreotate acetate is a somatostatin analog. Tyr3-Octreotate acetate exhibits high uptake into tumor, that is capable to be labeled with radioactive metal and thus exhibits antitumor efficacy. Tyr3-Octreotate acetate can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
-
- HY-P1329A
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP TFA is a potent and highly selective μ-opioid receptor antagonist. CTOP TFA antagonizes the acute analgesic effect and hypermotility. CTOP TFA enhances extracellular dopamine levels in the nucleus accumbens. CTOP TFA dose-dependently enhances locomotor activity .
|
-
- HY-P5626
-
|
Bacterial
|
Infection
|
Seabream hepcidin is an antimicrobial peptide with anti-bacterial (V.anguillarum), fungal (S.cerevisiae) and viral hemorrhagic septicemia virus activity .
|
-
- HY-P3507A
-
ShK-186 TFA
|
Potassium Channel
|
Metabolic Disease
Inflammation/Immunology
|
Dalazatide (ShK-186) TFA is a specific Kv1.3 potassium channel peptide inhibitor. Dalazatide TFA can be used in the study of autoimmune diseases such as multiple sclerosis (MS), lupus erythematosus, psoriasis, rheumatoid arthritis, type 1 diabetes and inflammatory bowel disease .
|
-
- HY-P1213
-
|
Melanocortin Receptor
|
Neurological Disease
|
JKC363, a selective melanocortin MC4 receptor antagonist, has a 90-fold higher affinity at the MC4 receptor (IC50=0.5 nM) than at the MC3 receptor (44.9 nM). JKC-363 blocks the stimulatory effect of α-MSH on TRH release. Anti-hyperalgesic effect .
|
-
- HY-P5153
-
μ-TRTX-Tp1a
|
Sodium Channel
|
Neurological Disease
|
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia .
|
-
- HY-P3064
-
Leiurotoxin I
|
Potassium Channel
|
Neurological Disease
|
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo .
|
-
- HY-P11071
-
|
PCSK9
|
Cardiovascular Disease
|
PCSK9 Inhibitor, EGF-A is a PCSK9 inhibitor. PCSK9 Inhibitor, EGF-A is residues 293-334 of the EGF-A domain of the low-density lipoprotein (LDL) receptor. PCSK9 Inhibitor, EGF-A can prevent PCSK9-induced intracellular LDLR degradation. PCSK9 Inhibitor, EGF-A can be used in the study of hypercholesterolemia and premature atherosclerosis .
|
-
- HY-P10126
-
|
Endogenous Metabolite
|
Others
|
Osteocalcin, bovine is a vitamin K-dependent bone specific protein. Osteocalcin, bovine is also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP). Osteocalcin, bovine is a small (49-amino-acid) noncollagenous protein hormone .
|
-
- HY-P4742A
-
6-FAM-AEEAC-SHK TFA
|
Biochemical Assay Reagents
Potassium Channel
|
Neurological Disease
|
6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) TFA (6-FAM-AEEAC-SHK TFA) is a peptide neurotoxin conjugated with a fluorescent marker. 6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) TFA can block voltage-gated potassium channels (kv1.1 and kv1.2) to prolong the duration of action potentials, thereby affecting the conduction of neural signals. 6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) TFA can be used in neuroscience research .
|
-
- HY-P4742
-
6-FAM-AEEAC-SHK
|
Biochemical Assay Reagents
|
Others
|
6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) (6-FAM-AEEAC-SHK) is a polypeptide that can be used as a Biochemical Assay Reagents.
|
-
- HY-P1213A
-
|
Melanocortin Receptor
|
Neurological Disease
|
JKC363 TFA, a selective melanocortin MC4 receptor antagonist, has a 90-fold higher affinity at the MC4 receptor (IC50=0.5 nM) than at the MC3 receptor (44.9 nM). JKC363 TFA blocks the stimulatory effect of α-MSH on TRH release. Anti-hyperalgesic effect .
|
-
- HY-P10046
-
|
Vasopressin Receptor
|
Metabolic Disease
|
[Deamino-Pen1,Val4,D-Arg8]-vasopressin (AVP-A) is an arginine-vasopressin (AVP) antagonist. AVP-A can significantly lower plasma aldosterone concentration in rats. AVP-A can be used for the research of the growth and steroidogenic capacity of rat adrenal zona glomerulosa .
|
-
- HY-P0191A
-
-
- HY-P1188
-
|
Integrin
|
Cancer
|
LDV-FITC, a fluorescent peptide, is a FITC-conjugated LDV peptide (HY-P2267). LDV-FITC binds to the α4β1 integrin with high affinity (Kd: 0.3 nM and 12 nM for binding to U937 cells in the presence and absence of Mn 2+ respectively). LDV-FITC can be used to detect α4β1 integrin affinity .
|
-
- HY-P5155
-
|
Potassium Channel
|
Neurological Disease
|
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats .
|
-
- HY-P10860
-
|
Factor Xa
|
Cardiovascular Disease
|
cMCoFx1 is a potent and selective FXIIa cyclic peptide inhibitor. cMCoFx1 has high binding affinity (KD: 900 pM) and inhibitory activity (Ki: 370 pM) for FXIIa. cMCoFx1 can effectively inhibit endogenous clotting pathways, and cMCoFx1 is stable in serum and non-cytotoxic .
|
-
- HY-P1188A
-
|
Integrin
|
Cancer
|
LDV-FITC TFA, a fluorescent peptide, is a FITC-conjugated LDV peptide (HY-P2267). LDV-FITC TFA binds to the α4β1 integrin with high affinity (Kd: 0.3 nM and 12 nM for binding to U937 cells in the presence and absence of Mn 2+ respectively). LDV-FITC TFA can be used to detect α4β1 integrin affinity .
|
-
- HY-P2785
-
-
- HY-106216
-
|
Elastase
|
Infection
Inflammation/Immunology
|
Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease .
|
-
- HY-P1959A
-
BIM 23014 acetate
|
Somatostatin Receptor
|
Endocrinology
Cancer
|
Lanreotide (BIM 23014) acetate is a somatostatin analogue with antineoplastic activity. Lanreotide acetate can be used for the research of carcinoid syndrome .
|
-
- HY-P1264F
-
|
nAChR
|
Neurological Disease
|
α-Bungarotoxin, FITC labeledis the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
-
- HY-P1215
-
|
Melanocortin Receptor
|
Metabolic Disease
|
HS024 is a selective MC4 receptor antagonist, with Kis of 0.29, 3.29, 5.45, and 18.6 nM for MC4, MC5, MC3, and MC1, respectively. HS024 increase food intake .
|
-
- HY-108055
-
|
Urotensin Receptor
Others
|
Cardiovascular Disease
|
Urantide is a selective and competitive urotensin-II (UT) receptor antagonist peptide (pKB=8.3) that blocks human urotensin-II (hU-II)-induced contractions in rat thoracic aorta ex vivo. Urantide can be used to study the (patho)physiological role of hU-II in the mammalian cardiovascular system .
|
-
- HY-P1959
-
-
- HY-P3955
-
-
- HY-P1408A
-
|
Integrin
|
Cancer
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
-
- HY-P0036B
-
SMS 201-995 pamoate
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) pamoate is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide pamoate can bind to the somatostatin receptors which are mainly subtypes 2, 3 and 5. Octreotide pamoate increases Gi activity and reduces intracellular cAMP production. Octreotide pamoate has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
-
- HY-P1442
-
|
Adrenergic Receptor
|
Cancer
|
AdTx1 is a selective α1A-adrenoceptor antagonist (Ki: 0.35 nM). AdTx1 can be used for research of benign prostatic hyperplasia .
|
-
- HY-103048A
-
|
PD-1/PD-L1
|
Cancer
|
PD-1/PD-L1-IN 3 TFA, a macrocyclic peptide, is a potent and selective inhibitor of the PD-1/PD-L1 and CD80/PD-L1 interactions extracted from patent WO2014151634A1, compound No.1. PD-1/PD-L1-IN 3 TFA interferes with PD-L1 binding to PD-1 and CD80 by binding to PD-L1, with IC50s of 5.60 nM and 7.04 nM, respectively. PD-1/PD-L1-IN 3 TFA can be used for the research of various diseases, including cancer and infectious diseases .
|
-
- HY-P1285
-
Con-R
|
iGluR
|
Neurological Disease
|
Conantokin R (Con-R) is an NMDA receptor peptide antagonist with an IC50 of 93 nM. Conantokin R binds Zn 2+ and Mg 2+ with Kds of 0.15 μM and 6.5 μM, respectively. Conantokin R shows anticonvulsant activity .
|
-
- HY-P0036
-
SMS 201-995
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide (SMS 201-995) can bind to the somatostatin receptor and mainly subtypes 2, 3, and 5, increases Gi activity, and reduces intracellular cAMP production. Octreotide (SMS 201-995) has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
-
- HY-P2974
-
EC 3.4.21.36; Pancreatopeptidase E
|
Elastase
|
Metabolic Disease
|
Elastase, Porcine pancreas (EC 3.4.21.36) is a single polypeptide chain of 240 amino acid residues, derived from pig pancreas. Elastase, Porcine pancreas is a serine protease that can hydrolyze proteins and polypeptide. Elastase from porcine pancreas can induce emphysema in hamsters .
|
-
- HY-P3143
-
|
PD-1/PD-L1
|
Cancer
|
BMSpep-57 is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 facilitates T cell function by in creasing IL-2 production in PBMCs .
|
-
- HY-P3499
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Dolcanatide is an orally active GC-C (guanylate cyclase-C) agonist. Dolcanatide shows laxative, anti-nociceptive and anti-inflammatory activity. Dolcanatide can be used in inflammatory bowel disease research .
|
-
- HY-P1408
-
|
Integrin
|
Cancer
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
-
- HY-P10693
-
-
- HY-P0061
-
-
- HY-P1215A
-
|
Melanocortin Receptor
|
Metabolic Disease
|
HS024 is a selective MC4 receptor antagonist, with Kis of 0.29, 3.29, 5.45, 18.6 nM for MC4, MC5, MC3, and MC1, respectively. HS024 increase food intake .
|
-
- HY-P2014
-
-
- HY-P10920
-
|
Drug Derivative
|
Cancer
|
DOTAMTATE is a somatostatin analogue. DOTAMTATE marked 212Pb is promising for research of somatostatin receptor positive neuroendocrine tumors .
|
-
- HY-P10572
-
-
- HY-P2026
-
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
|
A 71915 is a highly potent and competitive natriuretic peptide receptor A (ANP, NPRA) antagonist (pKi= 9.18). A 71915 displaces [ 125I]ANP dose dependently, with a Ki of 0.65 nM. A71915( pA2= 9.48) against rat ANP-induced cGMP production in NB-OK-1 cells .
|
-
- HY-P1980
-
|
Apoptosis
|
Metabolic Disease
|
A-71915 (TFA) is a selective inhibitor of ANP receptor (atrial natriuretic peptide-receptor), induces apoptosis and decreases insulin secretion in RINm5F pancreatic β-cells .
|
-
- HY-P5140
-
|
Calcium Channel
|
Metabolic Disease
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
-
- HY-103048
-
|
PD-1/PD-L1
|
Cancer
|
PD-1/PD-L1-IN 3, a macrocyclic peptide, is a potent and selective inhibitor of the PD-1/PD-L1 and CD80/PD-L1 interactions extracted from patent WO2014151634A1, compound No.1. PD-1/PD-L1-IN 3 interferes with PD-L1 binding to PD-1 and CD80 by binding to PD-L1, with IC50s of 5.60 nM and 7.04 nM, respectively. PD-1/PD-L1-IN 3 can be used for the research of various diseases, including cancer and infectious diseases .
|
-
- HY-P5175
-
|
mAChR
|
Neurological Disease
|
Muscarinic toxin 7 is a peptide toxin with selective and noncompetitive antagonism at the muscarinic M1 receptor .
|
-
- HY-P3143A
-
|
PD-1/PD-L1
|
Cancer
|
BMSpep-57 hydrochloride is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 hydrochloride binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 hydrochloride facilitates T cell function by in creasing IL-2 production in PBMCs .
|
-
- HY-P0061B
-
RC160 diacetate; BMY 41606 diacetate
|
Neurokinin Receptor
|
Cancer
|
Vapreotide diacetate is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM.
|
-
- HY-P0061A
-
RC-160 acetate; BMY-41606 acetate
|
Neurokinin Receptor
|
Cancer
|
Vapreotide acetate (RC-160 acetate; BMY-41606 acetate) is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM.
|
-
- HY-P1959B
-
BIM 23014 diTFA
|
Somatostatin Receptor
|
Endocrinology
Cancer
|
Lanreotide (BIM 23014) diTFA is a somatostatin analogue with antineoplastic activity. Lanreotide diTFA can be used for the research of carcinoid syndrome .
|
-
- HY-P5162
-
|
Sodium Channel
|
Inflammation/Immunology
|
Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities .
|
-
- HY-P5144
-
-
- HY-P5152
-
|
Sodium Channel
|
Neurological Disease
|
Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials .
|
-
- HY-P1335
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
-
- HY-P5833
-
κ-Bgt
|
nAChR
|
Neurological Disease
|
κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM .
|
-
- HY-P10230
-
|
Bacterial
|
Infection
|
Sublancin is an antimicrobial peptide, which inhibits DNA replication, transcription and translation, without affecting membrane integrity. Sublancin suppresses glucose uptake for the competition of phosphotransferase system (PTS). Sublancin inhibits B. subtilis strain 168 ΔSPβ with MIC of 0.312 μM .
|
-
- HY-P2592
-
-
- HY-P1330
-
|
P2X Receptor
|
Inflammation/Immunology
|
Purotoxin 1 is a P2X3 receptor inhibitor. Purotoxin 1 shows antinociceptive properties in animal models of inflammatory pain. Purotoxin 1 can be isolated from the venom of the wolf spider Geolycosa sp .
|
-
- HY-P10273A
-
|
Radionuclide-Drug Conjugates (RDCs)
Biochemical Assay Reagents
|
Cancer
|
DOTA-Octreotide TFA is composed of chelator DOTA and Octreotide (HY-P0036). DOTA-Octreotide TFA is used for research of cancer through combination with radioactive elements. DOTA-Octreotide TFA can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
-
- HY-P1426A
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA is specific blocker of Kv4 channel. AmmTX3 TFA inhibits the A-type K + current (Ki: 131 nM) .
|
-
- HY-P5917
-
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
Vm24-toxin (Vaejovis mexicanus peptide 24), a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
-
- HY-P5182A
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
-
- HY-P0178A
-
|
Integrin
|
Inflammation/Immunology
|
LXW7 TFA, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 TFA increases phosphorylation of VEGFR-2 and activation of ERK1/2. Anti-inflammatory effect .
|
-
- HY-P5568
-
RP 71955
|
HIV
|
Infection
|
RP 71955 is an antimicrobial peptide against HIV-1 .
|
-
- HY-P5165
-
|
Potassium Channel
|
Inflammation/Immunology
|
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K + current with an IC50 of 2 nM .
|
-
- HY-P1335A
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP TFA is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP TFA displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP TFA can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
-
- HY-P4764
-
|
Melanocortin Receptor
|
Cardiovascular Disease
|
Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 is a cyclic octapeptide with MC4R agonism. Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 significantly increases heart rate and blood pressure .
|
-
- HY-P4897
-
-
- HY-P5920
-
-
- HY-P1726
-
-
- HY-P5917A
-
Vaejovis mexicanus peptide 24 TFA
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
Vm24-toxin (Vaejovis mexicanus peptide 24) TFA, a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin TFA shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin TFA folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin TFA attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
-
- HY-P10273
-
-
- HY-P0178
-
|
Integrin
|
Inflammation/Immunology
|
LXW7, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 increases phosphorylation of VEGFR-2 and activation of ERK1/2. Anti-inflammatory effect .
|
-
- HY-P5182
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
-
- HY-P1443
-
|
Sodium Channel
|
Cancer
|
OD1 is a scorpion α-toxin that can be isolated from the venom of the Iranian yellow scorpion (Odonthobuthus doriae. OD1 is a modulator of mammalian Nav1.7 (EC50: 4.5 nM) .
|
-
- HY-P10730
-
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
DOTA-Lanreotide is a radionuclide conjugate (RDC), which is capable of binding to a radionuclide. RDC has the ability to specifically target biomolecules and can be used in medical imaging or therapy .
|
-
- HY-P1726A
-
|
Melanocortin Receptor
|
Cancer
|
MSG606 TFA is a potent human MC1 receptor antagonist (IC50=17 nM). MSG606 TFA also partial agonist at human MC3 and MC5 receptors (EC50 values are 59 and 1300 nM, respectively). MSG606 TFA exhibits binding affinity for A375 melanoma cells in vitro. MSG606 TFA reverses the induced hyperalgesia in female mice, with no effect in male mice.
|
-
- HY-P5931
-
Potassium channel toxin alpha-KTx 6.13; SPX; α-KTx6.13
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers .
|
-
- HY-P5174
-
|
Sodium Channel
|
Neurological Disease
|
MitTx is a complex formed by MitTx-α and MitTx-β. MitTx is an ASIC1 channel activator with EC50 values of 9.4 and 23 nM for ASIC1a and ASIC1b isoforms, respectively. MitTx is highly selective for ASIC1 isoforms at neutral pH. Under acidic conditions, MitTx greatly enhances proton-evoked ASIC2a channel activation .
|
-
- HY-P4521
-
|
MMP
|
Others
|
Ac-Pro-Leu-Gly-[(S)-2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OEt is a MMP12 substrate, and can be used to detect MMP12 enzyme activity .
|
-
- HY-P1102
-
TC14012
3 Publications Verification
|
CXCR
HIV
|
Infection
Cancer
|
TC14012, a serum-stable derivative of T140, is a selective and peptidomimetic CXCR4 antagonist with an IC50 of 19.3 nM. TC14012 is a potent CXCR7 agonist with an EC50 of 350 nM for recruiting β-arrestin 2 to CXCR7. TC14012 has anti-HIV activity and anti-cancer activity .
|
-
- HY-P4745
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
hMCH-1R antagonist 1 (Compound 30) is an effective and selective antagonist of human melanin-concentrating hormone receptor 1 (hMCHR1) with an KB value of 3.6 nM. HMCH-1R antagonist 1 can bind to hMCHR1 and hMCHR2 with IC50 values of 65 nM and 49 nM, respectively. HMCH-1R antagonistist 1 can be used for metabolic research .
|
-
- HY-P2005
-
|
Reactive Oxygen Species (ROS)
SOD
|
Others
|
Malformin C is an algicidal peptide can be isolated from Aspergillus and exhibits dose-dependent algicidal activity. Malformin C induces a significant increase in ROS levels in algal cells, resulting in impaired SOD activity and high production of MDA content .
|
-
- HY-P1102A
-
|
CXCR
HIV
|
Infection
Cancer
|
TC14012 TFA, a serum-stable derivative of T140, is a selective and peptidomimetic CXCR4 antagonist with an IC50 of 19.3 nM. TC14012 TFA is a potent CXCR7 agonist with an EC50 of 350 nM for recruiting β-arrestin 2 to CXCR7. TC14012 TFA has anti-HIV activity and anti-cancer activity .
|
-
- HY-P1682A
-
POL6326 TFA
|
CXCR
Arrestin
|
Cancer
|
Balixafortide TFA (POL6326 TFA) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide TFA shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide TFA blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide TFA is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
-
- HY-P2112
-
DOTA-Nal3-octreotide
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Others
|
DOTA-NOC (DOTA-Nal3-octreotide) is a high-affinity ligand of somatostatin receptor subtypes 2, 3 and 5. DOTA-NOC can be used for labeling with various radiometals, and development of radiopeptide imaging . DOTA-NOC can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
-
- HY-P1682
-
POL6326
|
CXCR
Arrestin
|
Cancer
|
Balixafortide (POL6326) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
-
- HY-17572A
-
-
- HY-P4397
-
|
Oxytocin Receptor
|
Endocrinology
|
(d(CH2)51,Tyr(Me)2,Thr4,Orn8,des-Gly-NH29)-Vasotocin, an oxytocin receptor antagonist, abolishes oxytocin-enhanced inhibitory postsynaptic currents in CA1 pyramidal neurons .
|
-
- HY-P4555
-
|
Somatostatin Receptor
|
Neurological Disease
|
(D-Phe5,Cys6,11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide (Compound 4) is a somatostatin analog with Kds of 0.61, 11.05, 23.5, 1200 and >1000 nM for SSTR5, SSTR3, SSTR2, SSTR1 and SSTR4, respectively .
|
-
- HY-P3561A
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-P5954
-
|
Calcium Channel
|
Others
|
PLTX-II is a calcium channel blocker. PLTX-II has a 44-residue peptide containing ten Cys residues and an O-palmitoylated threonine amide at the carboxy-terminus .
|
-
- HY-P5006
-
d(CH2)5[Tyr(Me)2, Dab5]AVP
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(d(CH2)51,Tyr(Me)2,Dab5,Arg8)-Vasopressin (d(CH2)5[Tyr(Me)2, Dab5]AVP) is a specific antagonist of vasopressin V1a receptor, with a pA2 of 6.71 .
|
-
- HY-P2244A
-
|
YAP
|
Cancer
|
YAP-TEAD-IN-1 TFA is a potent and competitive peptide inhibitor of YAP-TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 TFA is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd= 40 nM) .
|
-
- HY-P3561
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-108719
-
|
Insulin Receptor
Akt
|
Metabolic Disease
Cancer
|
Insulin glargine is a long-acting insulin analog. Insulin glargine has the effect of lowering blood sugar and can be used in the research of diabetes. In addition, high doses of Insulin glargine can promote the proliferation of bladder cancer cells .
|
-
- HY-106302
-
Moli1901; Lancovutide
|
Bacterial
|
Infection
Inflammation/Immunology
|
Duramycin (Moli1901) is a lantibiotic derived from Streptomyces cinnamoneuma. Duramycin also is a antimicrobial peptide. Duramycin can be used for the research of cystic fibrosis (CF) .
|
-
- HY-131374
-
|
CXCR
|
Cancer
|
TN14003 is a CXCR4 inhibitor. TN14003 has antitumor activity .
|
-
- HY-P2244
-
|
YAP
|
Cancer
|
YAP-TEAD-IN-1 is a potent and competitive inhibitor of?YAP–TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd=40 nM) .
|
-
- HY-P3215A
-
|
Oxytocin Receptor
|
Endocrinology
|
Oxytocin parallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P10698
-
|
Peptide-Drug Conjugates (PDCs)
LDLR
|
Neurological Disease
|
VH-N412 is a vectorized neuropeptide (NT) with good blood-brain barrier permeability. VH-N412 binds to the low-density lipoprotein receptor (LDLR) and neuropeptide receptor 1 (NTSR-1), and acts as a pharmacological-induced hypothermia (PIH) inducer. VH-N412 exhibits anticonvulsant and neuroprotective effects, and can be used in the study of neurological diseases such as epilepsy.
|
-
- HY-P4957
-
|
Somatostatin Receptor
|
Others
|
Octreotide dimer parallel is a dimer parallel of Octreotide. Octreotide (HY-P0036) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue .
|
-
- HY-P3215
-
|
Oxytocin Receptor
|
Endocrinology
|
Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P1717A
-
Cp40 TFA
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 TFA (Cp40 TFA), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 (Cp40) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
-
- HY-P1717B
-
Cp40 acetate
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 acetate (Cp40 acetate), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 acetate (Cp40 acetate) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
-
- HY-P10378
-
|
GnRH Receptor
|
Metabolic Disease
|
GPR10 agonist 1 (compound 18-S4) is a potent GPR10 agonist with EC50 values of 80, 7.8 nM in the presence (10%) or absence (0%) of FBS, respectively. GPR10 agonist 1 has the potential for the research of chronic obesity .
|
-
- HY-P1717
-
Cp40
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 (Cp40), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 (Cp40) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
-
- HY-P1162
-
-
- HY-125628
-
|
Endogenous Metabolite
|
Infection
|
Kahalalide A is an anti-mycobacterial compound with antimicrobial activity. Kahalalide A is derived from the marine mollusk Elysia rufescens. Kahalalide A has attracted extensive attention in natural product research due to its potential medicinal value .
|
-
- HY-P4469
-
-
- HY-P2434
-
|
Somatostatin Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC50: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .
|
-
- HY-P3124
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190, a somatostatin analog, a selective SSTR2 and SSTR5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
-
- HY-P3124A
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190 hydrochloride, a somatostatin analog, a selective SSRT2 and SSRT5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
-
- HY-P10204
-
|
Wnt
|
Cancer
|
FZD7 antagonist 1 (peptide 34) is a dFz7-21 analogue. FZD7 antagonist 1 is an FZD7 antagonist that inhibits the wnt3a with IC50 value of 9.2 nM. FZD7 antagonist 1 blocks TcdB−FZD interaction via targeting FZD receptors .
|
-
- HY-P10563
-
BHV-1100
|
CD38
|
Cancer
|
Noraramtide (BHV-1100) is an antibody recruitment molecule. Noraramtide can specifically bind to CD38 molecules to recruit natural killer (NK) cells. Noraramtide enhances the ability of NK cells to kill tumor cells through antibody-dependent cellular cytotoxicity (ADCC). This mechanism allows NK cells to more effectively recognize and eliminate tumor cells while avoiding mutual killing between NK cells. Noraramtide can be used for the study of autologous cancer immunity .
|
-
- HY-P0171
-
BKT140 (4-fluorobenzoyl); BL-8040; TF14016
|
CXCR
|
Endocrinology
Cancer
|
Motixafortide (BKT140 4-fluorobenzoyl) is a novel CXCR4 antagonist with an IC50 vakue of ~1 nM.
|
-
- HY-P4895
-
|
Oxytocin Receptor
|
Neurological Disease
|
(d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin (OVT) is an oxytocin receptor antagonist. (d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin can be used for the research of neurological disease .
|
-
- HY-A0248A
-
|
Bacterial
|
Infection
|
Polymyxin B1 is a potent antimicrobial lipopeptide first derived from Bacilus polymyxa. Polymyxin B1 is the major component in Polymyxin B (HY-A0248). Polymyxin B1 can induce lysis of bacterial cells through interaction with their membranes. Polymyxin B1 has the potential for multidrug-resistant Gram-negative bacterial infections treatment .
|
-
- HY-P10934
-
LXY2
|
Integrin
|
Cancer
|
LXY3 (LXY2) is a VLA-3-blocking peptide that inhibits the interaction between integrin α3β1 (VLA-3) on neutrophil surfaces and laminin in the basement membrane, thereby preventing neutrophil migration across the tumor vascular basement membrane barrier. LXY3 is used to block neutrophil-mediated nanoparticle release from perivascular pools into the tumor interstitium. LXY3 is commonly employed for targeted imaging of breast cancer .
|
-
- HY-P4890A
-
-
- HY-P5362A
-
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 TFA can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 TFA is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas. NODAGA-LM3 TFA can be labeled with [68Ga] for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
-
- HY-P5362
-
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas. NODAGA-LM3 can be labeled with [68Ga] for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
-
- HY-P4452
-
-
- HY-P4890
-
-
- HY-P0041A
-
-
- HY-P1955
-
Velcalcetide; AMG 416; KAI-4169
|
CaSR
|
Metabolic Disease
|
Etelcalcetide (AMG 416; KAI-4169) is a synthetic calcimimetic as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis, which is promising for research in the field of secondary hyperparathyroidism and chronic kidney disease .
|
-
- HY-P0041
-
-
- HY-105168
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
TAK 044 is an antagonist of Endothelin Receptor. TAK 044 strongly inhibits ET-induced deterioration in various animal models. TAK 044 can be used in study ET-related diseases such as acute myocardial infarction,acute renal failure, acute hepatic malfunction, and subarachnoid hemorrhage .
|
-
- HY-17365
-
-
- HY-P3432
-
|
Biochemical Assay Reagents
|
Others
|
DfTat is a dimer of the prototypical cell-penetrating peptide TAT. DfTat can deliver small molecules, peptides and proteins into live cells with a particularly high efficiency. DfTat labeled with the rhodamine can be used as a tracer for easy detection .
|
-
- HY-P0003A
-
Brain Natriuretic Peptide-32 human acetate; BNP-32 acetate
|
Natriuretic Peptide Receptor (NPR)
Calcium Channel
|
Cardiovascular Disease
|
Nesiritide (Brain Natriuretic Peptide-32 human) acetate is a recombinant human B-type natriuretic peptide. Nesiritide acetate is a NPRs agonist, with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide acetate regulates V1/2 activation/inactivation of the L-type calcium channel. Nesiritide acetate shows vasodilatory, diuretic, and natriuretic activities. Nesiritide acetate is used in cardiovascular diseases such as heart failure and vascular remodeling after arterial injury .
|
-
- HY-P10964
-
|
GHSR
|
Endocrinology
|
Tezusomant is a growth hormone receptor antagonist. Tezusomant is promising for research of diseases such as acromegaly caused by excessive growth hormone secretion .
|
-
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P1334
-
-
- HY-P4058
-
CGRP free acid
|
CGRP Receptor
|
Neurological Disease
|
Calcitonin gene-related peptide (CGRP) free acid is the deamidated form of α-CGRP(human) (HY-P1071). Calcitonin gene-related peptide can be used to study the effect of C-terminal amidation on CGRP .
|
-
- HY-108003
-
-
- HY-P4062
-
BIL
|
Insulin Receptor
|
Metabolic Disease
|
Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins .
|
-
- HY-P5978
-
ANP 127-150 (rat)
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
|
Atriopeptin III (ANP 127-150) (rat), a 24-amino acid atrial peptide, is a potent vasodilator and natriuretic/diuretic agent. Atriopeptin III (rat) improves renal functions and decreases blood pressure in a ureter-obstructed rat kidney model. Atriopeptin III (rat) can be used for research of chronic renal failure .
|
-
- HY-P3765
-
|
Peptides
|
Cardiovascular Disease
|
Auriculin A is a synthetic atrial natriuretic factor (ANF) with hemodynamic effect. Auriculin A antagonizes renal vasoconstriction in the dog, and influences on arterial baroreflex control of heart rate, systemic blood pressure, and perfusion pressure in the hind limb (perfused at constant flow) in rabbits .
|
-
- HY-P3952
-
|
Somatostatin Receptor
|
Metabolic Disease
|
(D-Trp8,D-Cys14)-Somatostatin-14 is a Somatostatin synthetic analogue. (D-Trp8,D-Cys14)-Somatostatin-14 can be used for the research of metabolic related diseases .
|
-
- HY-P4237
-
-
- HY-P4204
-
|
Bacterial
|
Infection
|
Ranalexin is an antimicrobial peptide. Ranalexin inhibits S. aureus, E. coli, P. aerugiaosa with MICs of 4, 32, 128 μg/mL .
|
-
- HY-P5601
-
|
Bacterial
Fungal
|
Infection
|
Thanatin is an inducible cationic antimicrobial peptide. Thanatin is a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
- HY-P5465
-
|
Bacterial
|
Others
|
Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)
|
-
- HY-P3062
-
-
- HY-P10788
-
|
Complement System
|
Cancer
|
CK3 peptide is an NRP-1 targeting peptide with the amino acid sequence CLKADKAKC. The CK3 peptide specifically binds to NRP-1 to target breast cancer cells. Single-photon emission computed tomography (SPECT) and near-infrared fluorescence (NIRF) imaging show significant accumulation of CK3 peptide in xenograft tumors in nude mice. CK3 peptide can be used for molecular imaging studies of breast cancer.
|
-
- HY-P2569
-
|
Apoptosis
|
Cancer
|
Malformin A1, a cyclic pentapeptide isolated from Aspergillus niger, possess a range of bioactive properties including antibacterial activity. Malformin A1 shows potent cytotoxic activities on human colorectal cancer cells. Malformin A1 induces apoptosis by activating PARP, caspase 3, -7, and -9 .
|
-
- HY-P1204A
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
[Ala17]-MCH TFA, a MCH analogue (HY-P1525A), is a selective ligand for MCHR1 (Ki=0.16 nM) over MCHR2 (Ki=34 nM). [Eu 3+ chelate-labeled [Ala17]-MCH shows high affnity for MCHR1 (Kd=0.37 nM) while has little demonstrable binding affnity for MCHR2 .
|
-
- HY-P4111
-
|
CXCR
|
Cancer
|
Peptide R, a cyclic peptide, is a specific CXCR4 antagonist. Peptide R shows outstanding capacities to profoundly remodel the tumor stroma. Peptide R has the potential for tumor research .
|
-
- HY-P1815A
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
- HY-P4111A
-
|
CXCR
|
Cancer
|
Peptide R (TFA) is a synthetic and specific CXCR4 antagonist. Peptide R (TFA) shows outstanding capacities to remodel the tumor stroma. Peptide R (TFA) can be used for solid tumor (glioblastoma, etc.) research .
|
-
- HY-P3767
-
ANP (126-150) (Rat); Atrial natriuretic peptide(126-150)(rat)
|
Peptides
|
Cardiovascular Disease
Metabolic Disease
|
Auriculin B (ANP (126-150) (Rat)) is a rat-derived atrial natriuretic peptide. Auriculin B has potent vasodilatory and diuretic properties .
|
-
- HY-P2612A
-
|
TNF Receptor
|
Others
Cancer
|
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
|
-
- HY-P5659
-
-
- HY-P3216
-
9-Deamidooxytocin
|
Oxytocin Receptor
|
Endocrinology
|
Oxytocin free acid (9-Deamidooxytocin) is an analog of oxytocin in which the glycinamide residue at position 9 in oxytocin has been replaced by a glycine residue. Oxytocin is a pleiotropic, peptide hormone with broad implications for general health, adaptation, development, reproduction, and social behavior .
|
-
- HY-P5660
-
|
Bacterial
|
Infection
|
Brevinin-2 is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P2687
-
Urodilatin (human)
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
|
Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure .
|
-
- HY-P1334A
-
-
- HY-P0122
-
c(CRGDKGPDC)
|
Integrin
|
Cancer
|
iRGD peptide is a 9-amino acid cyclic peptide, triggers tissue penetration of agents by first binding to αv-integrins, then proteolytically cleaved in the tumor to produce CRGDK/R to interact with neuropilin-1, and has tumor-targeting and tumor-penetrating properties.
|
-
- HY-P3624
-
|
Guanylate Cyclase
|
Cardiovascular Disease
|
Cenderitide is a potent agonist of particulate guanylyl cyclase receptor (pGC). Cenderitide is a natriuretic peptide (NP) composed of C-type natriuretic peptide (CNP) fused to the C-terminus of Dendroaspis natriuretic peptide (DNP). Cenderitide activates both pGC-A and pGC-B, activates the second messenger cGMP, suppresses aldosterone, and preserves GFR without reducing blood pressure. Cenderitide can be used for heart failure research .
|
-
- HY-P5662
-
|
Bacterial
|
Infection
|
Brevinin-2EC is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P4703
-
|
Oxytocin Receptor
|
Others
|
Hydrin 1′ is found in the neurohypophysis of Xenopus. Hydrin 1′ possesses a considerable steroid-releasing activity in Xenopus adrenal gland in vitro. Hydrin 1′ targets oxytocin receptor and derives a fluorescent probe of the oxytocin receptor .
|
-
- HY-P5656
-
|
Bacterial
|
Infection
|
Brevinin-1Ea is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P1178A
-
|
Trk Receptor
|
Neurological Disease
|
Cyclotraxin B TFA is a BBB-penetrable and selective TrkB inhibitor. Cyclotraxin B TFA inhibits BDNF-induced TrkB activity in a non-competitive manner, with an IC50 of 0.30 nM. Cyclotraxin B TFA has analgesic and anxiolytic effects .
|
-
- HY-P3710
-
|
Calcium Channel
|
Others
|
Ser-Ala-alloresact is a sperm activating peptide (SAP). The peptides released from eggs of marine invertebrates play a central role in fertilization .
|
-
- HY-P10102
-
Kp7-6
1 Publications Verification
|
Apoptosis
|
Metabolic Disease
Cancer
|
Kp7-6, a Fas mimetic peptide, is a Fas/FasL antagonist. Kp7-6 protects cells from Fas-mediated apoptosis, and protects mice from Fas-mediated hepatic injury .
|
-
- HY-P4916
-
|
Peptides
|
Others
|
Somatostatin-14 (3-14) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P1205A
-
Melanin-concentrating hormone(human, mouse, rat) TFA
|
MCHR1 (GPR24)
|
Neurological Disease
|
MCH (human, mouse, rat) TFA is a potent peptide agonist of MCH-R and exhibits binding IC50 values of 0.3nM and 1.5 nM for MCH1R and MCH2R, respectively. MCH (human, mouse, rat) is a highly sensitive to MCH-2R in a CHO cell line and monitoring mobilization of intracellular calcium with FLIPR, exhibits functional activation EC50 values of 3.9 nM and 0.1nM for human MCH-1R and MCH-2R, respectively .
|
-
- HY-P1565
-
TD 1 Disulfide(peptide)
|
Na+/K+ ATPase
|
Inflammation/Immunology
|
Transdermal Peptide Disulfide (TD 1 Disulfide(peptide)) is a 11-amino acid peptide, binds toNa +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide can enhance the transdermal delivery of many macromolecules .
|
-
- HY-P3503
-
BMN 111
|
FGFR
|
Others
|
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research .
|
-
- HY-P2469
-
-
- HY-P5601A
-
|
Bacterial
Fungal
|
Infection
|
Thanatin TFA is an inducible cationic antimicrobial peptide. Thanatin TFA s a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin TFA displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin TFA has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
- HY-P1018
-
-
- HY-P1205
-
Melanin-concentrating hormone(human, mouse, rat)
|
MCHR1 (GPR24)
|
Neurological Disease
|
MCH (human, mouse, rat) is a potent peptide agonist of MCH-R and exhibits binding IC50 values of 0.3nM and 1.5 nM for MCH1R and MCH2R, respectively. MCH (human, mouse, rat) is a highly sensitive to MCH-2R in a CHO cell line and monitoring mobilization of intracellular calcium with FLIPR, exhibits functional activation EC50 values of 3.9 nM and 0.1nM for human MCH-1R and MCH-2R, respectively .
|
-
- HY-P1949
-
|
CXCR
|
Cardiovascular Disease
Cancer
|
Cyclic MKEY is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY also protects against stroke-induced brain injury in mice .
|
-
- HY-P1178
-
|
Trk Receptor
p38 MAPK
|
Neurological Disease
|
Cyclotraxin B is a BBB-penetrable and selective TrkB inhibitor. Cyclotraxin B inhibits BDNF-induced TrkB activity in a non-competitive manner, with an IC50 of 0.30 nM. Cyclotraxin B has analgesic and anxiolytic effects .
|
-
- HY-P1815
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
- HY-P3503A
-
BMN 111 acetate
|
FGFR
|
Others
|
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth .
|
-
- HY-P1165
-
-
- HY-P2612
-
|
TNF Receptor
|
Others
|
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
|
-
- HY-P1949A
-
|
CXCR
|
Cardiovascular Disease
Cancer
|
Cyclic MKEY TFA is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY TFA also protects against stroke-induced brain injury in mice .
|
-
- HY-P1204
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
[Ala17]-MCH, a MCH analogue (HY-P1525A), is a selective ligand for MCHR1 (Ki=0.16 nM) over MCHR2 (Ki=34 nM). [Eu 3+ chelate-labeled [Ala17]-MCH shows high affnity for MCHR1 (Kd=0.37 nM) while has little demonstrable binding affnity for MCHR2 .
|
-
- HY-P5658
-
|
Bacterial
|
Infection
|
Brevinin-1E is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
- HY-P3898
-
- HY-P3066
-
d(CH2)5Tyr(Et)VAVP
|
Vasopressin Receptor
|
Metabolic Disease
|
SKF 100398 (d(CH2)5Tyr(Et)VAVP), an arginine vasopressin (AVP) analogue, is a specific antagonist of the antidiuretic effect of exogenous and endogenous AVP .
|
- HY-P1791B
-
Lactoferricin B acetate; Lfcin B acetate
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B) acetate, a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 acetate has antitumor activities .
|
- HY-P3060
-
|
Peptides
|
Cardiovascular Disease
|
Atriopeptin II rat, mouse is an atrial natriuretic peptide, which acts as diuretic and natriuretic agent, and a potent relaxant of vascular smooth muscle .
|
- HY-P5322
-
|
Transmembrane Glycoprotein
|
Cardiovascular Disease
Cancer
|
Thrombospondin (TSP-1)-derived CD36 binding motif is a bioactive hexapeptide. Thrombospondin (TSP-1)-derived CD36 binding motif interferes with the interaction between cells and the extracellular matrix by binding to CD36 and angiostatin, thereby affecting the cell adhesion and migration process. Thrombospondin (TSP-1)-derived CD36 binding motif inhibits platelet aggregation. Thrombospondin (TSP-1)-derived CD36 binding motif exerts an anti-tumor effect against colon cancer .
|
- HY-P10320
-
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
|
- HY-P4680
-
|
MCHR1 (GPR24)
|
Neurological Disease
|
(Phe13,Tyr19)-MCH (human, mouse, rat) is a potent SLC-1 and S643b receptor ligand. (Phe13,Tyr19)-MCH (human, mouse, rat) can be used as an agonist for SLC-1 and S643b receptor .
|
- HY-P10259
-
pBNP-32
|
Natriuretic Peptide Receptor (NPR)
|
Neurological Disease
|
BNP(1-32), porcine (pBNP-32) is a cardiac hormone. BNP(1-32), porcine is an atrial natriuretic peptide, which exhibits natriuretic, diuretic and vasorelaxant effects. BNP(1-32), porcine affects passive avoidance learning in rats with dopaminergic, cholinergic, α-and β-adrenergic mediation .
|
- HY-P2545
-
- HY-P5188A
-
- HY-P0123
-
|
Peptides
|
Others
|
SPACE peptide is a skin penetrating peptide (SPPs). SPACE peptide can enhance topical delivery of a macromolecule, hyaluronic acid .
|
- HY-P0203B
-
- HY-P3557
-
- HY-P1573A
-
- HY-P1390A
-
|
Vasopressin Receptor
|
Endocrinology
|
d[Cha4]-AVP TFA is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP TFA shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
- HY-P10388
-
|
CD47
TGF-β Receptor
|
Cancer
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
- HY-P1525A
-
MCH (salmon) (TFA)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
- HY-P4159
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P1420
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
- HY-P10833
-
|
VEGFR
PI3K
Akt
mTOR
ERK
Apoptosis
|
Cardiovascular Disease
Cancer
|
C-VGB3 is a selective vascular endothelial growth factor receptor 2 (VEGFR2) antagonist, which inhibits VEGFR2-mediated PI3K/AKT/mTOR and PLCγ/ERK1/2 signaling pathways. C-VGB3 binds to the extracellular domain of VEGFR2, blocking ligand-receptor interaction and inducing apoptosis in endothelial and tumor cells through both intrinsic (involving Bcl2 family and caspases) and extrinsic (death receptor-mediated) pathways. C-VGB3 is promising for research of angiogenesis-related cancers, such as breast cancer .
|
- HY-P3557A
-
- HY-P1164
-
- HY-P4906
-
|
Peptides
|
Others
|
Atrial Natriuretic Factor (5-27) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3217
-
|
Oxytocin Receptor
|
Endocrinology
|
[Asp5]-Oxytocin is the first 5-position neurohypophyseal hormone analogue possessing significant biological activity. [Asp5]-Oxytocin causes uterine contractions in vitro, enhanced by Mg 2+. [Asp5]-Oxytocin has the ability of rat uteroconstrictor, avian vasodilator, and rat antidiuretic .
|
- HY-P2196
-
- HY-P2093
-
S961
5 Publications Verification
|
Insulin Receptor
|
Metabolic Disease
|
S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
- HY-P1164A
-
- HY-P3825
-
CCAP
|
Peptides
|
Cardiovascular Disease
|
Crustacean cardioactive peptide (CCAP) is a insect cardioregulatory peptides that contmns 9 amino acid, first isolated from the tobacco hawkmoth, Manduca sexta. There are two cystemes at pnsttons 3 and 9 forming a disulfide bridge and the carboxyl-terminns is amldated .
|
- HY-P1547
-
|
GHSR
|
Neurological Disease
|
Somatostatin-25 is a endogenous neuropeptide hormone that shows inhibitory activity against secretion of growth hormone.
|
- HY-17571
-
α-Hypophamine; Oxytocic hormone
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
Oxytocin (α-Hypophamine; Oxytocic hormone) is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
- HY-P10793
-
|
EGFR
Apoptosis
|
Cancer
|
Cyclic(YCDGFYACYMDV) is a HER2 signaling pathway inhibitor with anti-cancer activity. This compound self-assembles into nanoparticles in aqueous solution and transforms into nanofibers upon specific binding to HER2 on cancer cells. This transformation disrupts HER2 dimerization and subsequent downstream signaling events, leading to cancer cell apoptosis (Apoptosis). The inhibitory effects on HER2 positive breast cancer have been demonstrated to be effective in a murine xenograft model .
|
- HY-P1556
-
|
PKG
|
Cardiovascular Disease
|
Vasonatrin Peptide (VNP) is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
- HY-P2249
-
|
Arrestin
Apelin Receptor (APJ)
|
Cardiovascular Disease
|
ELA-21 (human) is an apelin receptor agonist with a pKi of 8.52. ELA-21 (human) completely inhibits Forskolin-induced cAMP production and stimulates β-arrestin recruitment with subnanomolar potencies. ELA-21 (human) is an agonist in G-protein-dependent and -independent pathways .
|
- HY-P1071A
-
Calcitonin gene-related peptide TFA
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) (TFA) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) (TFA) is widely distributed in the central and peripheral nervous system. α-CGRP(human) (TFA) is a potent vasodilator and has inotropic and chronotropic effects .
|
- HY-P1789A
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
- HY-P3217A
-
|
Oxytocin Receptor
|
Endocrinology
|
[Asp5]-Oxytocin acetate is the first 5-position neurohypophyseal hormone analogue possessing significant biological activity. [Asp5]-Oxytocin acetate causes uterine contractions in vitro, enhanced by Mg 2+. [Asp5]-Oxytocin acetate has the ability of rat uteroconstrictor, avian vasodilator, and rat antidiuretic .
|
- HY-P5129
-
|
Peptides
|
Others
|
ASB20123 is a CNP/ghrelin chimeric peptide. ASB20123 stimulate bone growth. ASB20123 can be used in research of growth disorders and dwarfism .
|
- HY-P10835
-
|
LAG-3
|
Cancer
|
LAG-3 cyclic peptide inhibitor C25 is a LAG-3 inhibitor. LAG-3 cyclic peptide inhibitor C25 has a high affinity with human LAG-3 protein with a Kd value of 0.66 μM. LAG-3 cyclic peptide inhibitor C25 can block the interaction of LAG-3 with HLA-DR (MHC-II) and activate CD8 + T cells. LAG-3 cyclic peptide inhibitor C25 can be used in the study of cancer .
|
- HY-P4723
-
|
Peptides
|
Others
|
Intermedin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5718
-
|
Bacterial
|
Infection
|
Brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Brevinin-1PMa also shows hemolytic activity .
|
- HY-P3218A
-
|
Drug Derivative
|
Endocrinology
|
[Glu4]-Oxytocin acetate is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of oxytocin-like molecules in aqueous solution .
|
- HY-P2196A
-
|
Apelin Receptor (APJ)
|
Cancer
|
ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.
|
- HY-P1420A
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY TFA is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY TFA disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
- HY-P1235
-
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
|
- HY-P5217
-
|
Peptides
|
Others
|
CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
|
- HY-P1519B
-
BNP (1-32), rat acetate
|
Angiotensin Receptor
|
Cardiovascular Disease
|
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
- HY-P3915
-
|
Bacterial
|
Infection
|
Esculentin 1A is a frog skin-derived antimicrobial peptide (AMP) with potent in vitro anti-Pseudomonas activity .
|
- HY-P3221
-
|
Oxytocin Receptor
|
Endocrinology
|
[Leu3]-Oxytocin, an oxytocin analogue, is derived by structural variation in sequence position 3 replaced by leucine (Leu) .
|
- HY-P10557
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
DAG peptide is a cyclic peptide. DAG peptide selectively recognizes a subset of astrocytes that are activated in Alzheimer's disease (AD) starting at an early stage of the disease. DAG peptide can be used as a tool to enhance the delivery of therapeutics and imaging agents to sites of vascular changes and astrogliosis in diseases associated with neuroinflammation .
|
- HY-P1236A
-
Atrial natriuretic factor (1-28) (rat, mouse) TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
- HY-P4587
-
|
Peptides
|
Metabolic Disease
|
(Glu13,17,20)-Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46). Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism .
|
- HY-P1112A
-
|
Endothelin Receptor
|
Cardiovascular Disease
Neurological Disease
|
Sarafotoxin S6a TFA , a sarafotoxin analogue, is a endothelin receptor agonist and has an ETA/ETB selectivity profile similar to that of Endothelin-3 (HY-P0204). Sarafotoxin S6a TFA elicits the pig coronary artery with an EC50 value of 7.5 nM .
|
- HY-P4911
-
|
CXCR
|
Cardiovascular Disease
|
SDF-1α (human) is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) can be used in cardiovascular disease research .
|
- HY-P4911A
-
|
CXCR
|
Cardiovascular Disease
|
SDF-1α (human) TFA is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) TFA can be used in cardiovascular disease research .
|
- HY-P5713
-
|
Bacterial
|
Infection
|
Des(8-14)brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Des(8-14)brevinin-1PMa also shows hemolytic activity .
|
- HY-P1212
-
CST-14 (mouse, rat)
|
Somatostatin Receptor
|
Neurological Disease
|
Cortistatin 14, mouse, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus .
|
- HY-P4308
-
|
Prolyl Endopeptidase (PREP)
|
Neurological Disease
|
Z-Pro-Pro-aldehyde-dimethyl acetal is a potent inhibitor of prolyl endopeptidase (PREP), a cytoplasmic serine endoprotease (IC50= 12 nM). Z-Pro-Pro-aldehyde-dimethyl acetal plays an important role in cognitive dysfunction in aging and neurodegenerative diseases including Alzheimer's disease .
|
- HY-P5011
-
- HY-P5792
-
ANP (3-28) (human)
|
Endothelin Receptor
|
Cardiovascular Disease
Metabolic Disease
|
Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)) is a peptide hormone that is synthesized and secreted by the atrial myocardium. Atrial natriuretic peptide (3-28) (human) is involved in the regulation of blood pressure, fluid balance, and electrolyte homeostasis .
|
- HY-P4997
-
|
Peptides
|
Others
|
Tyr-Uroguanylin (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P2093B
-
|
Insulin Receptor
|
Metabolic Disease
|
S961 acetate is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
- HY-P1525
-
MCH (salmon)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
- HY-P11074
-
|
Bacterial
|
Infection
|
Sakacin P is an antimicrobial peptide that targets Gram-positive bacteria (such as Listeria monocytogenes) and belongs to Class IIa bacteriocin. Sakacin P has almost no antimicrobial activity against Gram-negative bacteria. Sakacin P exerts its antimicrobial activity by interacting with bacterial cell membranes and destroying membrane integrity. Sakacin P can be used for the study of Listeria contamination and antimicrobial drugs in the food industry.
|
- HY-P1508A
-
Bactenecin, bovine TFA
|
Bacterial
Fungal
|
Infection
|
Bactenecin TFA (Bactenecin, bovine TFA) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin TFA inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin TFA increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei .
|
- HY-P0058B
-
- HY-P1508
-
Bactenecin, bovine
|
Bacterial
Fungal
Antibiotic
|
Infection
|
Bactenecin (Bactenecin, bovine) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei .
|
- HY-P0058
-
- HY-P5127
-
- HY-P5645
-
Human liver expressed antimicrobial peptide-2
|
Peptides
|
Infection
|
LEAP-2 is an antimicrobial peptide derived from human blood .
|
- HY-P10828
-
|
Virus Protease
|
Infection
Inflammation/Immunology
|
MAPI is a polypeptide irreversible 3C cysteine protease (SV3CP) inhibitor. MAPI inhibits SV3CP by covalently binding its C-terminal Michael-acceptor extension to the active site thiol of SV3CP Cys 139. MAPI is promising for research of noroviruses infection .
|
- HY-P1237A
-
- HY-P10826
-
|
PD-1/PD-L1
|
Cancer
|
PD-1/PD-L1 inhibitory peptide C8 is inhibits PD-1/PD-L1 interaction, promotes the activation of CD8+ and CD4+ T cells, and increases the IFN-γ secretion. PD-1/PD-L1 inhibitory peptide C8 exhibits antitumor efficacy in mouse model .
|
- HY-P3226
-
|
IGF-1R
|
Metabolic Disease
|
JB-1, an IGF-1 peptide analog, is a selective and potent IGF-1R antagonist. JB-1 competes with IGF-1 by binding the IGF-1 receptor. JB-1 prevents the autophosphorylation of IGF-1R, and has no activity in IGF-II .
|
- HY-P4588
-
|
GLUT
|
Metabolic Disease
|
(Glu17,21,24)-Osteocalcin (1-49) (human) is a bone-specific protein involved in bone formation and glucose metabolism .
|
- HY-P3954
-
|
Somatostatin Receptor
|
Metabolic Disease
|
Somatostatin-28 (sheep, human rat mouse) is a biologically active polypeptide, synthesised in the proximal intestinal epithelial cells. Somatostatin-28 (sheep, human rat mouse) suppresses glucose-stimulated insulin secretion without affecting circulating basal insulin concentration. Somatostatin-28 (sheep, human rat mouse) also targets to somatostatin receptor subtype 5 (SSTR5) to regulate GLP-1 secretion .
|
- HY-P5624
-
|
Bacterial
|
Infection
|
Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 μM concentration .
|
- HY-P1753
-
|
HIV
|
Infection
|
VIR-165 is a modified form of virus inhibitory peptide (VIRIP) that binds the fusion peptide of the gp41 subunit and prevents its insertion into the target membrane. VIRIP inhibits a wide variety of human immunodeficiency virus type 1 (HIV-1) strains .
|
- HY-P1565A
-
TD 1 Disulfide(peptide) TFA
|
Na+/K+ ATPase
|
Others
|
Transdermal Peptide Disulfide TFA (TD 1 Disulfide(peptide) TFA) is a 11-amino acid peptide, binds to Na +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide TFA can enhance the transdermal delivery of many macromolecules .
|
- HY-P1519
-
BNP (1-32), rat
|
Angiotensin Receptor
|
Cardiovascular Disease
|
Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
- HY-P1179A
-
|
Guanylate Cyclase
Endogenous Metabolite
|
Metabolic Disease
|
Guanylin(human) TFA, a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) TFA is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism .
|
- HY-P3627
-
|
Drug Derivative
|
Cancer
|
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis .
|
- HY-P5495
-
|
Peptides
|
Others
|
Uroguanylin-15 (Rat) is a biological active peptide. (Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.)
|
- HY-P5080
-
|
Peptides
|
Others
|
Big Endothelin-2 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P2250
-
ELA-32 negative control
|
Apelin Receptor (APJ)
|
Others
|
ELA RR>GG (ELA-32 negative control), an ELABELA (ELA-32 human) mutant peptide, is inactive. ELA RR>GG is a negative control for ELABELA (HY-P2196) .
|
- HY-P1600
-
|
Peptides
|
Others
|
Tyr-Somatostatin-14 is a customized peptide that adds a Tyrosine amino acid to Somatostatin-14.
|
- HY-P10260
-
- HY-P4728
-
|
Peptides
|
Others
|
Intermedin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P10248
-
|
Androgen Receptor
|
Endocrinology
|
Atriopeptin I rat, mouse is an atrial natriuretic peptide, which stimulates the testosterone production with half-maximum stimulation of 38 nM .
|
- HY-P5059
-
- HY-P3912A
-
|
Interleukin Related
|
Infection
|
Endotoxin inhibitor TFA is a synthetic peptide that binds lipid A with high affinity, thereby detoxifying LPS (HY-D1056) and preventing LPS-induced cytokine release in vivo. Endotoxin inhibitor TFA inhibits the febrile response to LPS with very low toxicity and lethality .
|
- HY-P1526
-
- HY-P1071
-
Calcitonin gene-related peptide
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) (Calcitonin gene-related peptide) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) is a potent vasodilator and has inotropic and chronotropic effects .
|
- HY-P1237
-
|
Histamine Receptor
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
|
C-Type Natriuretic Peptide (CNP) (1-22), human, a 1-22 fragment of CNP, is a natriuretic peptide receptor B (NPR-B) agonist. C-Type Natriuretic Peptide (CNP) (1-22), human inhibits cAMP synthesis stimulated by the physiological agonists histamine and 5-HT or directly by Forskolin. CNP is a potent, endothelial-derived relaxant and growthinhibitory factor .
|
- HY-P1573
-
- HY-P1791
-
Lactoferricin B; Lfcin B
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B), a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 has antitumor activities .
|
- HY-P2526
-
LyP-1
2 Publications Verification
|
Complement System
|
Cancer
|
LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
- HY-P2273
-
|
CGRP Receptor
|
Metabolic Disease
|
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research .
|
- HY-P1179
-
|
Guanylate Cyclase
Endogenous Metabolite
|
Endocrinology
Cancer
|
Guanylin(human), a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism .
|
- HY-P1235A
-
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Carperitide acetate (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide acetate inhibits endothelin-1 secretion in a dose-dependent way.
|
- HY-P0203A
-
CGRP (83-119), mouse, rat TFA
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
α-CGRP (mouse, rat) TFA, a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) TFA can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) TFA has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
- HY-P1487
-
|
Peptides
|
Neurological Disease
|
Pressinoic Acid is a synthetic hexapeptide with potent corticotrophin-releasing activity. Pressinoic Acid is also an oxytocin inhibitor; it induces maternal behavior.
|
- HY-P4159B
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) acetate is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) acetate is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P3218
-
|
Oxytocin Receptor
|
Endocrinology
|
[Glu4]-Oxytocin is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of “oxytocin-like” molecules in aqueous solution .
|
- HY-P1236
-
Atrial natriuretic factor (1-28) (rat, mouse)
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
- HY-P0003
-
Brain Natriuretic Peptide-32 human; BNP-32
|
Natriuretic Peptide Receptor (NPR)
Calcium Channel
|
Cardiovascular Disease
|
Nesiritide (Brain Natriuretic Peptide-32 human) is a recombinant human B-type natriuretic peptide. Nesiritide is a NPRs agonist, with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide regulates V1/2 activation/inactivation of the L-type calcium channel. Nesiritide shows vasodilatory, diuretic, and natriuretic activities. Nesiritide is used in cardiovascular diseases such as heart failure and vascular remodeling after arterial injury .
|
- HY-P3957
-
|
Urotensin Receptor
|
Others
|
Urotensin II, teleost fish is a cyclic peptide. It can be isolated from the caudal neurosecretory system of teleost fish .
|
- HY-P3692
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART (55-76), rat is a neuropeptide (55-76 residues of the CART peptide) and constitutes the N-terminal fragments of CART (55-102). CART (55-76), rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (55-76), rat can induce anxiety and stress-related behavior .
|
- HY-P0058A
-
- HY-P4159A
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P4860
-
|
Akt
Gli
JNK
PKA
|
Metabolic Disease
|
Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway .
|
- HY-P10486
-
|
Bacterial
|
Infection
|
AIP-II is a macrocyclic peptide signaling molecule used for quorum sensing, which can be produced be Staphylococcus aureus. AIP-II binds to AgrC-II receptor, regulates the virulence gene expression in Staphylococcus aureus. AIP-II is an antagonist for AgrC-I receptor .
|
- HY-P2093A
-
|
Insulin Receptor
|
Metabolic Disease
|
S961 TFA is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
- HY-P1556A
-
|
PKG
|
Metabolic Disease
|
Vasonatrin Peptide (VNP) TFA is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide TFA possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide TFA protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
- HY-17571A
-
α-Hypophamine acetate; Oxytocic hormone acetate
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
Oxytocin (α-Hypophamine) acetate is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin acetate can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
- HY-P4205
-
|
Aminopeptidase
|
Cancer
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
- HY-P0084
-
SRIF-14; Somatostatin-14
|
Endogenous Metabolite
|
Cardiovascular Disease
Neurological Disease
|
Cyclic somatostatin (SRIF-14) is a growth hormone-release inhibiting factor used in the research of severe, acute hemorrhages of gastroduodenal ulcers. Cyclic somatostatin is a neuropeptide co-stored with acetylcholine in the cardiac parasympathetic innervation, exerts influences directly on contraction of ventricular cardiomyocytes. Cyclic somatostatin inhibits the contractile response of isoprenaline with an IC50 value of 13 nM. Cyclic somatostatin can be used for the research of cardiovascular disease .
|
- HY-P3707
-
|
Apoptosis
|
Cancer
|
Tumor targeted pro-apoptotic peptide (CNGRC-GG-D(KLAKLAK)2) is an anti-tumor peptide. Tumor targeted pro-apoptotic peptide disrupts mitochondrial membranes and promotes apoptosis, showing anticancer activity in mice .
|
- HY-P0203
-
CGRP (83-119), mouse, rat
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
α-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
- HY-P1112
-
- HY-P4320
-
|
Integrin
|
Cancer
|
Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys (Disulfide bridge: Cys1-Cys10), a decapeptide containing a cyclic RGD active sequence, is an Integrin αIIbβ3 antagonist that inhibits platelet and Adhesion of proMMP-13 .
|
- HY-P4767
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (1-13) (human) is a fragment and a residues within amyloid cores of Amylin (human IAPP). Amylin is a glucose-regulating hormone, deposits as amyloid fibrils in condition of type II diabetes (T2D). Amylin (1-13) (human) has no effect on firbl formation, as it cannot form fibrils by itself .
|
- HY-P2526A
-
|
Peptides
|
Cancer
|
LyP-1 TFA is a cyclic 9 amino acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
- HY-P10323
-
Tumstatin (74-98), human
|
Integrin
FAK
mTOR
Apoptosis
|
Cancer
|
T7 peptide is an endothelial cell-specific inhibitor. T7 peptide interacts with αVβ3 integrin to inhibit the FAK, PI3-kinase, PKB/Akt, and mTOR signaling pathways in endothelial cells, ultimately suppressing protein synthesis and inducing apoptosis .
|
- HY-P3912
-
|
COX
Interleukin Related
|
Infection
|
Endotoxin inhibitor a synthetic peptide that binds lipid A with high affinity, thereby detoxifying LPS (HY-D1056) and preventing LPS-induced cytokine release in vivo. Endotoxin inhibitor inhibits the febrile response to LPS with very low toxicity and lethality .
|
- HY-P1789
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
- HY-P1282A
-
- HY-P1632
-
|
Bacterial
|
Infection
Cancer
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
- HY-P1631
-
|
Bacterial
|
Infection
|
Polyphemusin I is a natural antimicrobial peptide with excellent antimicrobial activity against Gram-negative and Gram-positive bacteria. Polyphemusin I contains 18 amino acids and is stabilized into an amphiphilic, antiparallel β-hairpin by two disulfide bridges .
|
- HY-P5780
-
|
Sodium Channel
|
Neurological Disease
|
π-TRTX-Hm3a is a 37-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. π-TRTX-Hm3a pH-dependently inhibits acid-sensing ion channel 1a (ASIC1a) with an IC50 of 1-2 nM and potentiates ASIC1b with an EC50 of 46.5 nM .
|
- HY-P4605A
-
- HY-P10947
-
|
Epigenetic Reader Domain
YAP
|
Cancer
|
MACTIDE-V is an orally active and selective peptide-drug conjugate targeting CD206. MACTIDE-V delivers Verteporfin (HY-B0146) to CD206 + tumor-associated macrophages (TAM) to inhibit the YAP/TAZ signaling pathway, prompting YAP exclusion from the nucleus, inducing TAM polarization toward an anti-tumoral phenotype with enhanced phagocytosis and antigen presentation, and boosting T cell infiltration and NK cell activity. MACTIDE-V suppresses primary tumor growth and lung metastasis in triple-negative breast cancer (TNBC) mouse models .
|
- HY-P3314
-
- HY-A0182A
-
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
- HY-P1440A
-
|
Potassium Channel
|
Neurological Disease
|
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit heart.
|
- HY-P1105
-
|
Chloride Channel
|
Neurological Disease
|
GaTx2 is a seletive and a high affinity inhibitor of ClC-2 channels with a voltage-dependent apparent KD of ∼20 pM. GaTx2 is a peptide toxin inhibitor from Leiurus quinquestriatus hebraeus venom. GaTx2 is useful in determining the role and the membrane localization of ClC-2 in specific cell types .
|
- HY-P0049A
-
Arg8-vasopressin diacetate; AVP diacetate; ADH
|
Apoptosis
Vasopressin Receptor
|
Neurological Disease
Cancer
|
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
|
- HY-P5166
-
|
Peptides
|
Others
|
Lys-Conopressin-G, a vasotocin-like peptide, can be isolated from the venom of the worm-hunting snail (conus imperialis) .
|
- HY-P4902
-
|
P-glycoprotein
HIV
|
Infection
|
Retrocyclin-1 is a kind of Theta-defensin. Retrocyclin-1 recognizes and binds to carbohydrate-containing surface molecules, to protect cells from HIV-1 infection. Retrocyclin-1 exhibits high affinity to fetuin, gp120 (Kd=35.4 nM), CD4 (Kd=31 nM), and galactosylceramide (Kd=24.1 nM) .
|
- HY-P5824
-
- HY-P1218
-
|
Sodium Channel
|
Neurological Disease
|
Phrixotoxin 3 is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
- HY-P3981
-
- HY-P3155
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
Ac-hMCH(6-16)-NH2 binds to and activates equally well both human MCH receptors present in the brain (non-selective agonist), with IC50 values of 0.16 nM and 2.7 nM for MCH-1R and MCH-2R .
|
- HY-P1483
-
- HY-P2311
-
- HY-P1574
-
Vasotocin, Argiprestocin, Arginine vasotocin
|
Oxytocin Receptor
|
Neurological Disease
|
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family .
|
- HY-106262B
-
KAI-9803 hydrochloride; BMS-875944 hydrochloride
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
- HY-P3099
-
|
Guanylate Cyclase
|
Cancer
|
Uroguanylin (human) is a natural ligand for the Guanylyl Cyclase (GCC) receptor expressed in metastatic colorectal cancer tumors. Uroguanylin (human) has anti-tumor actions in an animal model for human colon cancer .
|
- HY-P10235
-
|
Amylin Receptor
|
Neurological Disease
|
Cyclic AC253 is an antagonist for amylin receptor, with IC50 of 0.3 μM. Cyclic AC253 exhibits neuroprotective efficacy against Aβ toxicity and abrogates Aβ-induced impairment of hippocampal long-term potentiation. Cyclic AC253 penetrate blood-brain barrier (BBB) .
|
- HY-P1548
-
Human β-CGRP; CGRP-II (Human)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P3055A
-
DTX-I TFA
|
Potassium Channel
|
Cancer
|
Dendrotoxin-I (DTX-I) TFA is a potent K + channel blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6. Dendrotoxin-I TFA, a neurotoxin, has the potential for cancer research .
|
- HY-P4127A
-
- HY-P1346A
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
- HY-P3979
-
HNP 4
|
Bacterial
|
Infection
|
Defensin HNP 4 (HNP 4) is a single 11 amino acid long fragment of HNP-41-11. Defensin HNP 4 has inhibitory effect against multidrug-resistant and non-resistant strains .
|
- HY-P5772
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-II, a 32 amino acid residues including two acidic and two basic residues, is a neurotoxin. Jingzhaotoxin-II inhibits voltage-gated sodium channels (VGSC) that significantly slows rapid inactivation of TTX-resistant (TTX-R) VGSC on cardiac myocytes with the IC50 of 0.26 μM .
|
- HY-P4990A
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
- HY-108905
-
Human IGF-I; FK 780
|
IGF-1R
|
Metabolic Disease
|
Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies .
|
- HY-P4912
-
|
Peptides
|
Others
|
Big Endothelin-1 (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-B1811
-
|
Endogenous Metabolite
|
Neurological Disease
|
Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
|
- HY-P2271
-
|
Apelin Receptor (APJ)
|
Cancer
|
MM 54 (compound 5) is a competitive antagonist at APJ, with an IC50 of 93 nM. MM 54 behaves as a potent and selective inhibitor of apelin binding and APLNR activation .
|
- HY-P1632A
-
|
Bacterial
|
Infection
Cancer
|
Tachyplesin I TFA is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I TFA exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
- HY-P1305
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior .
|
- HY-P1073
-
|
Calcium Channel
Sodium Channel
Potassium Channel
|
Cancer
|
ProTx-I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. ProTx-I is also a potent blocker for voltage-gated Na + channels and inhibits KV 2.1 channels .
|
- HY-P4942
-
|
Peptides
|
Others
|
Biotinyl-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5632
-
|
Bacterial
|
Infection
|
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively .
|
- HY-P4810
-
T140
|
CXCR
|
Infection
|
Polyphemusin II-Derived Peptide (T140), a CXCR4 inhibitor, shows high inhibitory activity against HIV-1 entry and the inhibitory effect on the binding of an anti-CXCR4 monoclonal antibody (12G5) to CXCR4 .
|
- HY-P3037
-
|
Calcium Channel
|
Neurological Disease
|
Imperatoxin A, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, activator of Ca 2+-release channels/ryanodine receptors (RyRs) enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
- HY-P4605
-
- HY-P1932
-
- HY-P1304
-
- HY-P2289
-
pBD-1
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
- HY-P3525
-
|
Integrin
|
Others
|
G-Pen-GRGDSPCA is an αvβ3-inhibiting RGD peptide. G-Pen-GRGDSPCA can limit neointimal hyperplasia and lumen stenosis after vascular injury, as well as regulate the migration and proliferation of smooth muscle cells. G-Pen-GRGDSPCA can be used in the study of the mechanism of vascular injury repair .
|
- HY-P5907
-
|
Opioid Receptor
|
Neurological Disease
|
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain .
|
- HY-P5773
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons .
|
- HY-P4127
-
|
Peptides
|
Neurological Disease
|
M65 is a deleted peptide of maxadilan (61 a.a.) with deletion of the residues between positions 24 and 42 and is a specific antagonist of PACAP type 1 receptor that inhibits ANP secretion and can be used for relevant researches .
|
- HY-P2601A
-
|
CGRP Receptor
|
Others
|
Tyr-α-CGRP (human) TFA is an N-terminally extended human α-CGRP analog. Tyr-α-CGRP (human) TFA can bind to membrane preparations from rat brain and spleen with IC50 values of 0.2 nM and 0.5 nM, respectively, and induce positive chronotropic and inotropic effects in isolated guinea pig right and left atria with EC50 values of 282 nM and 74 nM, respectively. Tyr-α-CGRP (human) TFA also inhibits contractile responses in rat vas deferens with an EC50 value of 1.9 nM .
|
- HY-P5017
-
|
Oxytocin Receptor
|
Endocrinology
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
- HY-P3235
-
|
Factor VIIa
|
Others
|
E-76 is a peptide with anticoagulant activity. E-76 inhibits blood coagulation by specifically binding to exogenous coagulation factor VIIa (FVIIa). E-76 can be used to study blood coagulation-related diseases .
|
- HY-P1548B
-
Human β-CGRP acetate; CGRP-II (Human) (acetate)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P5014
-
- HY-P10237
-
|
Calcium Channel
|
Others
|
Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and bone resorption in neonatal rat osteoclasts .
|
- HY-103303
-
|
CGRP Receptor
|
Metabolic Disease
|
CRSP-1 is short for calcitonin receptor-stimulating peptide-1. CRSP-1 inhibits osteoclast formation by inhibiting the formation and activity of multinucleated osteoclast .
|
- HY-P1282
-
- HY-P1427A
-
|
Potassium Channel
|
Neurological Disease
|
Guangxitoxin 1E TFA is the TFA salt form of Guangxitoxin 1E (HY-P1427). Guangxitoxin 1E TFA is a peptide toxin and a selective inhibitor for voltage-gated potassium channel KV2.1 and KV2.2 with IC50 of 1-3 nM. Guangxitoxin 1E TFA enhances glucose-stimulated intracellular calcium ion oscillations and increases insulin secretion in a glucose-dependent manner .
|
- HY-P3953
-
- HY-P1464
-
Amylin (rat)
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
|
- HY-P1304A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(human) TFA is a human satiety factor with potent appetite-suppressing activity. CART(55-102)(human) TFA is closely associated with leptin and neuropeptide Y .
|
- HY-P5114A
-
|
Calcium Channel
|
Others
|
Maurocalcine TFA is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine TFA induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine TFA exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine TFA can be applied to in vivo cell tracking or other cell imaging techniques .
|
- HY-P1218A
-
|
Sodium Channel
|
Neurological Disease
|
Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
- HY-P1070
-
DAP amide, human
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
- HY-P5081
-
|
Peptides
|
Inflammation/Immunology
|
Endotrophin (Mus musculus) is a cleavage product of collagen 6 (Col6). Endotrophin upregulation of both profibrotic and proinflammatory genes .
|
- HY-P1036
-
|
Complement System
|
Others
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
- HY-P1455A
-
Human adrenomedullin-(1-52)-NH2 TFA
|
Peptides
|
Cancer
|
Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer.
|
- HY-P4008
-
dVDAVP
|
Vasopressin Receptor
|
Endocrinology
|
[Deamino-4-valine, 8-D-arginine]-Vasopressin (dVDAVP) is a highly potent and specific antidiuretic agent possessing protracted effects .
|
- HY-12554A
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
Terlipressin diacetate is a vasopressin analogue with potent vasoactive properties. Terlipressin diacetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin diacetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin diacetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
- HY-P1574A
-
- HY-P5642
-
RC-101
|
Bacterial
|
Infection
|
Retrocyclin-101 is an antimicrobial peptide against of bacterial and viral .
|
- HY-P1163A
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
D[LEU4,LYS8]-VP TFA is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP TFA has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
- HY-P11009
-
|
Peptides
|
Others
|
SA-21 is a 21-amino acid polymer peptide (Ac-RLIEDICLPRWGCLWEDD-NH2) that binds to ligands of urokinase-type plasminogen activator, Fab antibody fragments, and small proteins. SA-21 can be used to purify albumin (Ki=1.9 μM) .
|
- HY-P1737
-
Con-S
|
Peptides
|
Cardiovascular Disease
|
Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM .
|
- HY-P2302
-
|
Antibiotic
Bacterial
Fungal
|
Infection
|
Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors .
|
- HY-P10996
-
Human Neutrophil Peptide-4 TFA
|
Bacterial
SARS-CoV
|
Infection
|
Corticostatin, human (Human Neutrophil Peptide-4) TFA is an antimicrobial peptide with demonstrated antiviral activity. Corticostatin, human TFA can kill Escherichia coli, Streptococcus faecalis, and Candida albicans. Corticostatin, human (HNP-4) TFA is more bactericidal against Gram-negative bacteria than any of HNP-1-3. Corticostatin, human TFA can be isolated from the azurophil granule fraction of discontinuous Percoll gradients .
|
- HY-P1871A
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
- HY-P0004
-
- HY-P1280A
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
- HY-P1455
-
Human adrenomedullin-(1-52)-NH2
|
Peptides
|
Cancer
|
Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide, which affects cell proliferation and angiogenesis in cancer.
|
- HY-P3899A
-
|
Somatostatin Receptor
|
Metabolic Disease
|
[Nle8] Somatostatin (1-28) TFA is a derivative of somatosttin (1-28) with norleucine replacing methionine in position 8. [Nle8] Somatostatin (1-28) TFA increases the amylase release.[Nle8] Somatostatin (1-28) TFA increases the cyclic AMP in pancreatic acini .
|
- HY-P4766
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (porcine) is a peptide that regulates vasodilation. Adrenomedullin (porcine) induces endothelium-dependent relaxation in rat aorta with IC50 value of 2.4 nM. Adrenomedullin (porcine) induces endothelium-independent relaxation of porcine coronary arteries with an IC50 of 27.6 nM .
|
- HY-P4990
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
- HY-P5407
-
|
Peptides
|
Others
|
HD5 is a biological active peptide. (a natural lectin-like human defensins-5 (HD5) peptide secreted by the Paneth cells in the crypts of Lieberkuhn, could interact with glycosylated proteins and lipid components)
|
- HY-P5071
-
|
Bacterial
|
Infection
|
EcAMP3 is a hairpin-like peptide. EcAMP3 has antifungal and antibacterial activity. EcAMPs precursor family contains seven identical cysteine motifs: C1XXXC2(11–13)C3XXXC4 .
|
- HY-P4791
-
|
Peptides
|
Others
|
Orexin A (1-15) (free acid) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P11008
-
|
Biochemical Assay Reagents
|
Others
|
DX-236 is a macrocyclic peptide with a binding affinity of 1.9 µM to human serum albumin (HSA). DX-236 can fuse with HSV to prolong its circulation in vivo.
|
- HY-P3089
-
|
Potassium Channel
|
Others
|
Dendrotoxin K is a Kv1.1 channel blocker. Dendrotoxin K determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
- HY-P3055
-
DTX-I
|
Potassium Channel
|
Neurological Disease
Cancer
|
Dendrotoxin-I (DTX-I) is a potent K + channels blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6, respectively. Dendrotoxin-I, a neurotoxin, has the potential for cancer research .
|
- HY-P1346
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
- HY-P1305A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior .
|
- HY-P1280
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
- HY-P10033
-
|
Ser/Thr Protease
|
Others
|
SFTI-1 is a cyclic peptide trypsin inhibitor consisting of 14 amino acid residues. SFTI-1 belongs to the Bowman-Birk class of inhibitors. Characterized by its small size, high stability, and potent activity, SFTI-1 can be used for research on peptide drug design platforms .
|
- HY-P5584
-
- HY-P4853
-
- HY-P1221A
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II TFA is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
- HY-P5790
-
|
Sodium Channel
|
Neurological Disease
|
μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II .
|
- HY-P5647
-
|
Bacterial
|
Infection
|
PhD1 is an antimicrobial peptide derived from monkey white blood cells. PhD1 has activity against bacteria and fungus Candida albicans .
|
- HY-P1168
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
[Orn8]-Urotensin II (human), a peptide analog of urotensin II, is a UT receptor agonist. [Orn8]-Urotensin II (human) increases intracellular calcium levels in HEK293 .
|
- HY-P1534
-
- HY-P1070A
-
DAP amide, human TFA
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
- HY-P5781
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1b is a 42-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. δ-Theraphotoxin-Hm1b selectively inhibits inactivation of NaV1.1 but have no effect on NaV1.7 .
|
- HY-P1440
-
- HY-106262
-
KAI-9803; BMS-875944
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
Delcasertib (KAI-9803) is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
- HY-P10079
-
- HY-P1913A
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
- HY-P1163
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
D[LEU4,LYS8]-VP is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
- HY-P1913
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
- HY-P1167A
-
- HY-P0049
-
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
- HY-P10817
-
|
Proton Pump
Reactive Oxygen Species (ROS)
|
Metabolic Disease
|
Corza6 is a potent and selective human voltage-gated proton channel (hHv1) peptide inhibitor. Corza6 binds to the external voltage sensor domain (VSD) loop in hHv1 with a Kd of ~1 nM at the natural, hyperpolarized resting membrane potential (RMP) of mammalian cells. Corza6 allows capacitation in sperm and permits sustained reactive oxygen species (ROS) production in white blood cells (WBCs) .
|
- HY-P4184
-
(Ser4,Ile8)-Oxytocin
|
Peptides
|
Others
|
Isotocin ((Ser4,Ile8)-Oxytocin) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3089A
-
|
Potassium Channel
|
Others
|
Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
- HY-W539944
-
Arg8-vasopressin acetate; AVP acetate
|
Vasopressin Receptor
Apoptosis
|
Neurological Disease
Cancer
|
Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
|
- HY-P10817A
-
|
Proton Pump
Reactive Oxygen Species (ROS)
|
Metabolic Disease
|
Corza6 TFA is a potent and selective human voltage-gated proton channel (hHv1) peptide inhibitor. Corza6 TFA binds to the external voltage sensor domain (VSD) loop in hHv1 with a Kd of ~1 nM at the natural, hyperpolarized resting membrane potential (RMP) of mammalian cells. Corza6 TFA allows capacitation in sperm and permits sustained reactive oxygen species (ROS) production in white blood cells (WBCs) .
|
- HY-P1074
-
|
Calcium Channel
|
Neurological Disease
|
SNX-482, a peptide, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect .
|
- HY-P1167
-
- HY-P4184A
-
(Ser4,Ile8)-Oxytocin acetate
|
Peptides
|
Others
|
Isotocin (acetate) ((Ser4,Ile8)-Oxytocin (acetate)) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3037A
-
|
Calcium Channel
|
Neurological Disease
|
Imperatoxin A TFA is a peptide toxin derived from the venom of the African scorpion Pandinus imperator. Imperatoxin A TFA is a Ca 2+-release channels/ryanodine receptors (RyRs) activator. Imperatoxin A TFA enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
- HY-P2289A
-
pBD-1 TFA
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
- HY-P1036A
-
|
Complement System
|
Others
|
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
- HY-P1221
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
- HY-P1871
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
- HY-P0090A
-
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
- HY-P3014
-
|
Potassium Channel
|
Others
|
Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1, Kv1.2, Kv1.3, and Kv1.6 of 31 pM, 170 pM, 86 pM,and 6000 pM, respectively .
|
- HY-P1078
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
- HY-P2150
-
|
Somatostatin Receptor
|
Neurological Disease
Inflammation/Immunology
|
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC50 values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .
|
- HY-P3219
-
|
Endogenous Metabolite
|
Endocrinology
|
N-Acetyloxytocin is isolated and characterized in the neurointermediate lobe of the rat pituitary (NIL) and their presence in several brain areas of the rat .
|
- HY-P1463A
-
Thyrocalcitonin eel TFA
|
Thyroid Hormone Receptor
|
Others
|
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis .
|
- HY-P4973
-
|
Peptides
|
Others
|
Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P2310
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities .
|
- HY-A0182
-
- HY-P0090
-
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
- HY-P1548A
-
Human β-CGRP TFA; CGRP-II (Human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P2491
-
|
Fluorescent Dye
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research .
|
- HY-P4976
-
- HY-P5694
-
|
HPV
Parasite
|
Infection
|
Human α-defensin 5 is an antiviral peptide. Human α-defensin 5 blocks infection of non-enveloped viruses, including AdV, HPV, and polyomaviruses (IC50: 0.6-1.25 μM for HPV16). Human α-defensin 5 can bind to the viral capsid and blocks escape of the virus from the endosome. Human α-defensin 5 increases HIV binding to the cell surface. Human α-defensin 5 also has parasiticidal activity .
|
- HY-P6053
-
|
Opioid Receptor
|
Neurological Disease
|
KK-103 is a precursor of leucine-enkephalin (Leu-ENK) overcomes high proteolytic instability of Leu-ENK via markedly increased plasma stability in mice that has antinociceptive effect .
|
- HY-P4934
-
|
Peptides
|
Others
|
Biotinyl-BNP-32 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3899
-
|
Somatostatin Receptor
|
Metabolic Disease
|
[Nle8] Somatostatin (1-28) is a derivative of somatosttin (1-28) with norleucine replacing methionine in position 8. [Nle8] Somatostatin (1-28) increases the amylase release.[Nle8] Somatostatin (1-28) increases the cyclic AMP in pancreatic acini .
|
- HY-P5319
-
|
Peptides
Calcium Channel
|
Others
|
MCaE12A is a high-affinity modulator of RyR2 and increases RyR2 sensitivity to cytoplasmic calcium concentrations promoting channel opening. MCaE12A acts as an important tool for RyR2 structure-to-function studies as well as for manipulating Ca2+ homeostasis and dynamic of cardiac cell .
|
- HY-P1427
-
|
Potassium Channel
|
Neurological Disease
|
Guangxitoxin 1E is a potent and selective blocker of KV2.1 and KV2.2 channels. Guangxitoxin 1E inhibits KV2 with an IC50 of 1-3 nM. KV2 channels underlie delayed-rectifier potassium currents in various neurons .
|
- HY-P3099A
-
|
Guanylate Cyclase
|
Cancer
|
Uroguanylin (human) (TFA) is a natural ligand for the Guanylyl Cyclase (GCC) receptor expressed in metastatic colorectal cancer tumors. Uroguanylin (human) (TFA) has anti-tumor actions in an animal model for human colon cancer .
|
- HY-P5603
-
BNBD-12
|
Bacterial
|
Infection
|
Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus .
|
- HY-P1633
-
PG1
|
Bacterial
ERK
COX
NF-κB
Apoptosis
NO Synthase
Dengue Virus
|
Infection
Inflammation/Immunology
|
Protegrin-1 is an orally active antibacterial peptide. Protegrin-1 activates ERK, COX2, NFκB, inhibits Apoptosis, and NO production. Protegrin-1 has antibacterial activity against S. aureus, E. faecium, E. coli, P. aeruginosa and K. Pneumoniae, with MBC values between 10 and 20 µM. Protegrin-1 has antiviral activity against dengue NS2B-NS3. Protegrin-1 has anti-inflammatory activity. Protegrin-1 is used in the study of inflammatory diseases and infections .
|
- HY-P5818
-
- HY-P2310A
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human TFA is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human TFA exhibits broad antimicrobial and anti-leishmanial activities .
|
- HY-P1766
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors .
|
- HY-P4994
-
- HY-P1932A
-
- HY-P1457
-
|
Peptides
|
Cardiovascular Disease
|
Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent.
|
- HY-P1463
-
Thyrocalcitonin eel
|
Thyroid Hormone Receptor
|
Endocrinology
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
- HY-P1078A
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
- HY-P5114
-
|
Calcium Channel
|
Others
|
Maurocalcine is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine can be applied to in vivo cell tracking or other cell imaging techniques .
|
- HY-P5631
-
|
Bacterial
|
Infection
|
Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils .
|
- HY-P1274
-
|
Potassium Channel
|
Inflammation/Immunology
|
ShK-Dap22 is a potent Kv1.3-specific immunosuppressive Polypeptide. ShK-Dap22 is a selective Kv1.3 channel blocker with IC50s of 23 pM, 1.8 nM, 10.5 nM, 37 nM, and 39 nM for mKv1.3, mKv1.1, hKv1.6, mKv1.4, and rKv1.2 channels, respectively .
|
- HY-12554B
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
- HY-P10758
-
- HY-P3656
-
|
Potassium Channel
|
Inflammation/Immunology
|
Kaliotoxin (1-37) is a toxin from the scorpion Artdroctonus mauretanicus mauretanicus. Kaliotoxin (1-37) is a potent calcium-dependent potassium channel blocker .
|
- HY-P5786
-
- HY-P5925
-
SsTx Toxin
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Ssm Spooky Toxin is found in Scolopendra mutilans that potently inhibits KCNQ (voltage-gated potassium channel family 7) channels, with IC50s of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin plays an essential role in the centipede’s circulatory system .
|
- HY-P5797
-
- HY-P10685
-
[Tyr5,12,Lys7]-Polyphemusin II
|
HIV
CMV
|
Infection
|
T-22 (polyphemusin II with [Tyr5,12,Lys7]) is a new synthetic peptide that fights HIV, with an EC50 of 0.008 μg/mL and a CC50 of 54 μg/mL. T22 promotes plant height, photosynthesis, total chlorophyll content, and gas exchange in tomatoes, and it can resist CMV .
|
- HY-P1403
-
|
Potassium Channel
|
Others
|
Tertiapin LQ is a specific and reversible renal outer medullary potassium ROMK1 (Kir1.1) channel inhibitor .
|
- HY-P10684
-
|
Bacterial
|
Infection
|
Polyphemusin II is an antimicrobial peptide which can be isolated from Limulus polyphemus hemocytes. Polyphemusin II exhibits antimicrobial activities against various Gram (+)/(-) bacteria and fungi .
|
- HY-P5791
-
- HY-P10869
-
|
Natriuretic Peptide Receptor (NPR)
|
Inflammation/Immunology
Cancer
|
dCNP binds to NPR-B/C receptor, activates cGMP signaling pathway, and regulates vascular function. dCNP exhibits anti-hypoxia property through downregulation of hypoxia-related genes expressions like HIF1α and HIF2α. dCNP inhibits the induction of tumor stroma and exhibits anti-fibrosis activity. dCNP upregulates CTLs, NK cells, and conventional type 1 dendritic cells in tumors, and activates immune responses .
|
- HY-P3483
-
|
PACAP Receptor
Caspase
Apoptosis
PKA
Interleukin Related
TNF Receptor
|
Cardiovascular Disease
Neurological Disease
|
Maxadilan is a specific irreversible PAC1 receptor agonist and a potent vasodilator peptide present in the salivary glands of sand flies. Maxadilan exhibits anti-apoptotic activity in hADSCs. Maxadilan inhibits pro-inflammatory cytokines (TNF-α) and enhances anti-inflammatory mediators (IL-10). Maxadilan can activate leukocytes and inhibit vascular permeability through PAC1 receptors. Maxadilan promotes neural differentiation of human adipose-derived stem cells. Maxadilan can be used to study endotoxin shock, atherosclerosis, and neurodegenerative diseases [1] [2] [3] [4] [5].
|
- HY-P3512
-
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
Cancer
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
- HY-P5853
-
|
Potassium Channel
|
Inflammation/Immunology
|
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research .
|
- HY-P10654
-
- HY-P3901
-
|
Somatostatin Receptor
|
Neurological Disease
|
[Leu8,D-Trp22,Tyr25] Somatostatin-28 is the analog of Somatostatin-28. Somatostatin-28 is a intestinal peptide containing somatostatin in its C-terminal portion .
|
- HY-P0256
-
- HY-P3900
-
- HY-P5644
-
|
Bacterial
|
Infection
|
Retrocyclin-3 is an antimicrobial peptide against human immunodeficiency virus, influenza A and herpes simplex virus .
|
- HY-P5089
-
- HY-P5901
-
- HY-P5628
-
|
Bacterial
|
Infection
|
Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity .
|
- HY-P5925A
-
SsTx Toxin TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Ssm Spooky Toxin TFA is found in Scolopendra mutilans that potently inhibits KCNQ (voltage-gated potassium channel family 7) channels, with IC50s of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin TFA inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin TFA plays an essential role in the centipede’s circulatory system .
|
- HY-P3563
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
[Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
|
- HY-P2171A
-
|
Peptides
|
Inflammation/Immunology
|
CCP peptide TFA is a synthetic cyclic citrullinated peptide (CCP) and used as the substrate for detecting anti-CCP antibodies serologically. CCP peptide TFA functions as a target for autoantibodies with a very high specificity for rheumatoid arthritis (RA) .
|
- HY-P0062
-
- HY-P1441
-
|
Sodium Channel
|
Others
|
Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation .
|
- HY-P5770
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V, a 29-residue polypeptide, is derived from the venom of the spider Chilobrachys jingzhao. Jingzhaotoxin-V inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 nM and 30.2 nM, respectively. Jingzhaotoxin-V also inhibits Kv4.2 potassium currents expressed in Xenpus Laevis oocytes (IC50 of 604.2 nM) .
|
- HY-P3384
-
|
Antibiotic
|
Others
Inflammation/Immunology
|
Pezadeftide is a potent antifungal peptide. Pezadeftide can enter fungal cells and cause a rapid mitochondrial response that results in hyperpolarization of the mitochondrial membrane .
|
- HY-P5816
-
|
Sodium Channel
|
Neurological Disease
|
BmK-M1 is a scorpion toxin, and is composed of 64 amino acids cross-linked by four disulfide bridges. BmK-M1 inhibits Na + channel and can be considered both as a cardiotoxin and a neurotoxin .
|
- HY-P4863
-
- HY-P1286
-
- HY-108741A
-
|
Guanylate Cyclase
|
Inflammation/Immunology
Cancer
|
Plecanatide acetate, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide acetate activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide acetate can be used for the research of chronic idiopathic constipation, and it also shows anti-inflammatory activity in models of murine colitis .
|
- HY-P5782
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1a toxin is a selective Nav1.1 activator. δ-Theraphotoxin-Hm1a toxin elicits pain and touch sensitivity. δ-Theraphotoxin-Hm1a toxin can be used for the research of irritable bowel syndrome .
|
- HY-P1189
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
- HY-P5813
-
β-TRTX-cd1a; β-Theraphotoxin-cd1a
|
Calcium Channel
|
Neurological Disease
|
Cd1a is a β-toxin derived from the African spider Ceratogyrus darlingi. Cd1a can regulate calcium ion channels. Cd1a inhibits human calcium ion channels (Cav2.2)(IC502.6 μM) and mouse sodium ion channels (Nav1.7). Cd1a can be used in the development of peripheral pain treatment drugs .
|
- HY-P2539
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
- HY-P4191
-
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
- HY-P4898
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone .
|
- HY-P0190A
-
|
Potassium Channel
|
Others
|
Iberiotoxin (TFA) is a selective high conductance high conductance Ca 2+-activated K + channel inhibitor with a Kd of ~1 nM. Iberiotoxin (TFA) does not block other types of voltage-dependent ion channels .
|
- HY-P4056
-
P15-Tat
|
Casein Kinase
Apoptosis
|
Cancer
|
CIGB-300 (P15-Tat) is an anti-casein kinase 2 (CK2) peptide that exhibits anticancer properties by interfering with the phosphorylation of protein kinase CK2. CIGB-300 induces apoptosis in multiple tumor cell lines and can be used in cancer research .
|
- HY-P4946
-
|
Peptides
|
Others
|
Biotinyl-α-CGRP (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-125053A
-
|
Glycoprotein VI
|
Cardiovascular Disease
|
Batifiban TFA, a cyclic peptide, is an antagonist of platelet glycoprotein GPⅡb/Ⅲa and inhibits platelet aggregation. Batifiban blocks the binding of circulating vitronectin to integrin ανβ3 .
|
- HY-P2699
-
GrTx; ω-GsTx SIA
|
Calcium Channel
|
Neurological Disease
|
ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases .
|
- HY-P4928
-
|
Amylin Receptor
|
Metabolic Disease
|
Biotinyl-Amylin (mouse, rat) is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
- HY-P1424A
-
|
Potassium Channel
|
Neurological Disease
|
Lei-Dab7 TFA is a high affinity, selective KCa2.2 (SK2) channel blocker (Kd=3.8 nM). Lei-Dab7 TFA exhibits >200-fold selectivity for KCa2.2 over KCa2.1, KCa2.3, KCa3.1, Kv and Kir2.1. Lei-Dab7 TFA increases theta-burst responses and increases LTP in rat hippocampal slices in vitro.
|
- HY-P4756
-
|
Peptides
|
Others
|
N-(2-Carbamoyl-ethyl)-Val-Leu-anilide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1441A
-
|
Sodium Channel
|
Neurological Disease
|
Mambalgin 1 TFA is a selective ASIC1a inhibitor (IC50 values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Mambalgin 1 TFA binds to closed/inactive channel. Mambalgin 1 TFA is selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Mambalgin 1 TFA increases latency of withdrawal response in mouse tail-flick and paw-flick tests.
|
- HY-P0207
-
Endothelin-2 (human, canine); Human endothelin-2
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
- HY-P5784
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 17nM. δ-Buthitoxin-Hj1a can be used for the Dravet syndrome (DS) research .
|
- HY-P4971
-
|
Complement System
|
Inflammation/Immunology
|
C5a Anaphylatoxin (human) is a pro-inflammatory peptide and a leukocyte chemoattractant. C5a Anaphylatoxin (human) can be used to study inflammation and immunity, such as allergic asthma .
|
- HY-P2707
-
α-DTX
|
Sodium Channel
Potassium Channel
|
Others
|
α-Dendrotoxin (α-DTX) is a small molecule peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). α-Dendrotoxin is also a KV1.1, KV1.2, KV1.6 and ASIC channel blocker. α-Dendrotoxin blocks potassium channels, lowers the threshold of neuronal action potentials, and increases the frequency of action potentials, thereby enhancing neuronal excitability. α-Dendrotoxin can be used in neurotoxicology research .
|
- HY-P5798
-
FAS-I
|
Cholinesterase (ChE)
|
Neurological Disease
|
Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes .
|
- HY-P5796
-
|
Calcium Channel
|
Neurological Disease
|
FS-2 is a potent and specific L-type CaV channel inhibitor. FS-2 inhibits high K + or glucose induced L-type Ca 2+ influx in RIN beta cells .
|
- HY-P5785A
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2 (TFA), a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
- HY-P10229
-
|
Peptides
|
Others
|
RALF1 peptide is endogenous signals that inhibits growth of plants through apoplast alkalinization and induction of auxin biosynthesis .
|
- HY-P5806
-
ErgTx1
|
Potassium Channel
|
Neurological Disease
|
Ergtoxin-1 is a potassium channel blocker.
Ergtoxin-1 is isolated from the venom of the Mexican scorpion
Centruroides noxius. Ergtoxin 1 can block
ERG-K + channels in nerve, heart and endocrine cells .
|
- HY-P5771
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .
|
- HY-P4898A
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A TFA is a soidum channel toxin. Anthopleurin-A TFA is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A TFA can be isolated from the sea anemone .
|
- HY-P5887
-
- HY-P5810
-
CcoTx2; β-TRTX-cm1b
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav1.3/β1, respectively .
|
- HY-P0204
-
- HY-P1189A
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
- HY-P4928A
-
|
Amylin Receptor
|
Metabolic Disease
|
Biotinyl-Amylin (mouse, rat) TFA is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
- HY-P1080A
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA TFA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA TFA has no effect on L-type or N-type calcium channels .
|
- HY-P3277
-
|
Ras
|
Cancer
|
KRpep-2d is a potent K-Ras inhibitor and inhibits proliferation of K-Ras-driven cancer cells. KRpep-2d can be used for cancer research .
|
- HY-P3448
-
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
- HY-P5870
-
|
Potassium Channel
|
Inflammation/Immunology
|
KTX-Sp2 is a potassium channel toxin. KTX-Sp2 effectively blocks three types of exogenous voltage-gated potassium channels: Kv1.1, Kv1.2 and Kv1.3. Ktx-Sp2 inhibits endogenous Kv1.3 and suppresses Ca 2+ signaling in Jurkat T cells. Ktx-Sp2 inhibits IL-2 secretion from activated Jurkat T cells .
|
- HY-P4869
-
|
Ras
|
Others
|
Biotin-KRpep-2d acetate is a biotin-labeled KRpep-2d (HY-P3277) .
|
- HY-P2949
-
|
Potassium Channel
|
Cancer
|
Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel .
|
- HY-P1079
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin TK, a peptidyl toxin of the venom of Agelenopsis aperta, is a potent and selective P/Q type Ca 2+ channel blocker. ω-Agatoxin TK inhibits the high K + depolarisation-induced rise in internal Ca 2+ in cerebral isolated nerve endings with an IC50 of of 60 nM. ω-Agatoxin TK has no effect on L-type, N-type, or T-type calcium channels .
|
- HY-P4191A
-
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
- HY-P1218B
-
|
Sodium Channel
|
Neurological Disease
|
Phrixotoxin 3-NH2 TFA is a derivative of Phrixotoxin 3 TFA (HY-P1218A). Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
- HY-P0202A
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P4056A
-
P15-Tat acetate
|
Casein Kinase
Apoptosis
|
Cancer
|
CIGB-300 acetate (P15-Tat acetate) is an anti-casein kinase 2 (CK2) peptide that exhibits anticancer properties by interfering with the phosphorylation of protein kinase CK2. CIGB-300 acetate induces apoptosis in multiple tumor cell lines and can be used in cancer research .
|
- HY-P1281
-
|
Potassium Channel
|
Neurological Disease
|
Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability .
|
- HY-P5809
-
- HY-P5788
-
|
Potassium Channel
|
Neurological Disease
|
Hemitoxin, a scorpion-venom peptide, is a K + channel blocker. Hemitoxin blocks rat Kv1.1, Kv1.2 and Kv1.3 channels expressed in Xenopus oocytes with IC50 values of 13 nM, 16 nM and 2 nM, respectively .
|
- HY-P3433
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
- HY-17571F
-
Biotin-α-Hypophamine; Biotin-Oxytocic hormone
|
Oxytocin Receptor
|
Others
|
Biotin-Oxytocin (Biotin-α-Hypophamine; Biotin-Oxytocic hormone) is a biological active peptide. (This is Oxytocin (HY-17571) N-terminally labeled with Biotin.)
|
- HY-P0190
-
|
Potassium Channel
|
Cardiovascular Disease
|
Iberiotoxin is a toxin isolated from Buthus tamulus scorpion venom. Iberiotoxin is a selective high conductance high conductance Ca 2+-activated K + channel inhibitor with a Kd of ~1 nM. Iberiotoxin does not block other types of voltage-dependent ion channels .
|
- HY-P2171
-
|
Peptides
|
Inflammation/Immunology
|
CCP peptide is a synthetic cyclic citrullinated peptide (CCP) and used as the substrate for detecting anti-CCP antibodies serologically. CCP peptide functions as a target for autoantibodies with a very high specificity for rheumatoid arthritis (RA) .
|
- HY-P5077A
-
|
Guanylate Cyclase
|
Metabolic Disease
|
Guanylin (mouse, rat) TFA, a petide, is composed of 15 amino acids. Guanylin (mouse, rat) TFA is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) TFA can be used for the research of diarrhea .
|
- HY-P4975
-
|
Peptides
|
Others
|
CART (61-102) (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5914A
-
WaTx TFA
|
TRP Channel
|
Neurological Disease
|
Wasabi Receptor Toxin TFA (WaTx TFA) is the TFA salt form of Wasabi Receptor Toxin (HY-P5914). Wasabi Receptor Toxin TFA is a cell-penetrating scorpion toxin. Wasabi Receptor Toxin TFA is the activator for TRPA1 ion channel with EC50 in nanomolar level, and prolongs the channel open time, but reduces Ca 2+ permeability. Wasabi Receptor Toxin TFA causes thermal hypersensitivity and mechanical allodynia in rats, without triggering neurogenic inflammation .
|
- HY-P5851
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaHI can be used as a tool for the development of active substances with toxin-neutralizing capabilities .
|
- HY-P5130
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic response in conscious Sprague-Dawley rats. Big endothelin-1 (rat 1-39) raises blood pressure in mice .
|
- HY-P5643
-
|
Bacterial
|
Infection
|
Retrocyclin-2 is an antimicrobial peptide against human immunodeficiency virus, influenza A and herpes simplex virus .
|
- HY-P4066
-
|
Interleukin Related
|
Cancer
|
Emfilermin is a recombinant human leukaemia inhibitory factor (LIF) that can be used in chemotherapy-induced peripheral neuropathy studies .
|
- HY-P10383
-
|
NO Synthase
|
Infection
|
SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
- HY-P4946A
-
|
Peptides
|
Others
|
Biotinyl-α-CGRP (human) TFA is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P0017
-
- HY-P2222
-
- HY-P0062A
-
- HY-P5873
-
JZTX-X
|
Potassium Channel
|
Neurological Disease
|
Jingzhaotoxin-X (JZTX-X) is a selective Kv4.2 and Kv4.3 potassium channels inhibitor. Jingzhaotoxin-X causes long-lasting mechanical hyperalgesia .
|
- HY-P10383A
-
|
NO Synthase
|
Infection
|
SPSB2-iNOS inhibitory cyclic peptide-1 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-1(HY-P10383). SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
- HY-P0062B
-
- HY-P0256A
-
Apamine TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Apamin TFA (Apamine TFA) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
- HY-P10851
-
|
Apoptosis
|
Inflammation/Immunology
Cancer
|
HVEM(14-39) is a B- and T-lymphocyte attenuator (BTLA) peptide inhibitor. HVEM (14-39) can be combined with BTLA with a KD of 0.102 μM. HVEM(14-39) enhances the activation and proliferation of T cells by regulating the expression of BTLA and HVEM in T cells, and promotes the transformation of cells into effector memory T cells. HVEM(14-39) inhibits tumor cell proliferation and promotes late apoptosis. HVEM(14-39) has immunomodulatory effects and can be used in the study of cancer .
|
- HY-P3655
-
|
Calcium Channel
|
Others
|
Agelenin is a polypeptide composed of 35 amino acids. Agelenin could be isolated from the Agelenidae spider Agelena opulenta. Agelenin has structural similarity to insect-specific calcium channel inhibitor .
|
- HY-P2710
-
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC50 = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease .
|
- HY-P5785
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
- HY-P1286A
-
- HY-P5089A
-
- HY-P2222A
-
- HY-P0202
-
- HY-P1220
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .
|
- HY-P5863
-
Mamb-2
|
Sodium Channel
|
Neurological Disease
|
Mambalgin-2 (Mamb-2) is an acid-sensitive ion channels (ASICs) inhibitor and a venom peptide. Mambalgin-2 can be obtained from the venom of the African black mamba. Mambalgin-2 can be used in the study of pain and neurological diseases .
|
- HY-P5811
-
CcoTx1; β-TRTX-cm1a
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1 .
|
- HY-P3903
-
|
Somatostatin Receptor
|
Endocrinology
|
[D-Trp8,Tyr11] Somatostatin is an analogue of somatostatin. Somatostatin is a hormone that regulates a variety of bodily functions. DTrp8 residue can increase stability .
|
- HY-P10962
-
- HY-125053
-
|
Integrin
|
Cardiovascular Disease
|
Batifiban, a cyclic peptide, is a platelet glycoprotein GPⅡb/Ⅲa antagonist, and inhibits platelet aggregation. Batifiban blocks circulating vitronectin binding to integrin ανβ3, Batifiban can be used for research of acute coronary syndromes .
|
- HY-P3571
-
|
Endothelin Receptor
|
Cancer
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
- HY-P3732
-
|
Integrin
|
Cancer
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
|
- HY-P1220A
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .
|
- HY-P3902
-
- HY-P5914
-
WaTx
|
TRP Channel
|
Neurological Disease
|
Wasabi Receptor Toxin is a cell-penetrating scorpion toxin. Wasabi Receptor Toxin is the activator for TRPA1 ion channel with EC50 in nanomolar level, and prolongs the channel open time, but reduces Ca 2+ permeability. Wasabi Receptor Toxin causes thermal hypersensitivity and mechanical allodynia in rats, without triggering neurogenic inflammation .
|
- HY-108741
-
|
Guanylate Cyclase
|
Inflammation/Immunology
Cancer
|
Plecanatide, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide shows anti-inflammatory activity in models of murine colitis .
|
- HY-P5793
-
- HY-P5736
-
|
Bacterial
|
Infection
|
Bass hepcidin is an antimicrobial activity against Escherichia coli. .
|
- HY-P10328
-
|
DNA/RNA Synthesis
|
Metabolic Disease
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
- HY-P2538
-
- HY-P3711
-
|
Na+/K+ ATPase
|
Others
|
SPAI-1 is a specific inhibitor for monovalent cation transporting ATPases. SPAI-1 is a peptide isolated from porcine duodenum, inhibits Na +, K +-ATPase and H +, K +-ATPase in vitro, stimulates Mg 2+-ATPase .
|
- HY-P1080
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA has no effect on L-type or N-type calcium channels .
|
- HY-P5795
-
|
Sodium Channel
Potassium Channel
|
Neurological Disease
|
GsAF-I is a potent Nav and hERG1 channels blocker with IC50s of 0.36, 0.6, 1.28, 0.33, 1.2, 0.04 and 4.8 μM against Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, Nav1.7 and hERG1, respectively .
|
- HY-P3277A
-
|
Ras
|
Cancer
|
KRpep-2d (TFA) is a potent K-Ras inhibitor and inhibits proliferation of K-Ras-driven cancer cells. KRpep-2d can be used for cancer research .
|
- HY-P5077
-
|
Guanylate Cyclase
|
Metabolic Disease
|
Guanylin (mouse, rat), a petide, is composed of 15 amino acids. Guanylin (mouse, rat) is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) can be used for the research of diarrhea .
|
- HY-102029
-
SRTX-c
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6c (SRTX-c) is a potent endothelin-B receptor agonist. Sarafotoxin S6c can cause vasoconstriction in both endothelium-intact and endothelium-denuded vessels .
|
- HY-P4941
-
|
Peptides
|
Others
|
Biotinyl-α-CGRP (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P0204A
-
- HY-P3565
-
STX-b
|
Calcium Channel
|
Cardiovascular Disease
|
Sarafotoxin S6d (STX-b) is a polypeptide toxin isolated from the venom of the Israeli sand boa constrictor. Sarafotoxin S6d induces multiple electrocardiogram (ECG) changes including myocardial ischemia and hyperkalemia. Sarafotoxin S6d induces strong extracellular calcium-dependent vasoconstriction in rat aorta and exhibits positive inotropic effects in rat atria. Sarafotoxin S6d can be used in the study of cardiovascular diseases .
|
- HY-P5651
-
|
Bacterial
|
Infection
|
PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Candida albicans .
|
- HY-P0207A
-
Endothelin-2 (49-69) (human, canine) TFA; Human endothelin-2 TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
Endothelin-2 (49-69), human (TFA) (Endothelin-2 (49-69) (human, canine) (TFA)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
- HY-P10272
-
PTG-300
|
Ferroportin
|
Others
|
Rusfertide is a peptide mimetic of natural hepcidin, which targets and degrades ferroportin, reduces serum iron and transferrin-saturation, and thus regulates the production of red blood cells. Rusfertide ameliorates the polycythemia vera, β-thalassemia and hereditary hemochromatosis .
|
- HY-P2331
-
Antibiotic A 3802-IV-3; Gardimycin
|
Antibiotic
|
Infection
|
Actagardin is a tetracyclic lantibiotic produced by several species of Actinoplanes. It is composed of macrocyclic rings formed by thioether bridges. Actagardin preferably targets Gram-positive bacteria, inhibiting the synthesis of peptidoglycan.
|
- HY-P10429
-
|
CXCR
|
Infection
|
RCP168 is a highly selective and affinity CXCR4 receptor antagonist (IC50=5 nM). RCP168 has a stronger ability than natural chemical factors to inhibit the entry of HIV-1 (human immunodeficiency virus type 1) into host cells via CXCR4 receptors. RCP168 inhibits HIV-1 infection by blocking viral binding sites or inducing receptor internalization. RCP168 can be used to analyze the interaction between CXCR4 receptor and other chemical factor receptors .
|
- HY-P5899
-
- HY-P5630
-
|
Bacterial
|
Infection
|
Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria .
|
- HY-P4678
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P5159
-
|
Sodium Channel
|
Inflammation/Immunology
|
Crotamine is a Na + channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom .
|
- HY-12537
-
- HY-P3204
-
POT-4
1 Publications Verification
AL-78898A
|
Complement System
|
Metabolic Disease
|
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
|
- HY-P5648
-
|
Bacterial
|
Infection
|
PhD2 is an antimicrobial peptide derived from monkey white blood cells. PhD2 has activity against bacteria and fungus Candida albicans .
|
- HY-P5738
-
|
Bacterial
|
Infection
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
- HY-P0083
-
POR-8
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Ornipressin (POR-8) is a vasopressin agonist specific for the V1 receptor. Ornipressin can be used as a local vasoconstrictor. Ornipressin can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin has antidiuretic activity. Ornipressin decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
- HY-P3269
-
|
Calcium Channel
|
Others
|
Calciseptine, a natural?neurotoxin?isolated from the black mamba Dendroaspis p. polylepis venom. Calciseptine consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type?calcium channel[1].
|
- HY-P1681A
-
|
Sodium Channel
|
Neurological Disease
|
GpTx-1 TFA is a peptide-based NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. GpTx-1 TFA demonstrates potent inhibitory activity against the NaV1.7 channel with an IC50 value of 10 nM, while exhibiting excellent selectivity for NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM), showing >20-fold and >950-fold selectivity respectively .
|
- HY-P5943
-
- HY-P3220
-
|
Oxytocin Receptor
|
Endocrinology
|
[D-Asn5]-Oxytocin possesses very low specific oxytocic and vasodepressor activities. By cumulative dose-response studies for oxytocic activity, [D-Asn5]-Oxytocin has similar intrinsic activity to oxytocin .
|
- HY-P2313
-
HβD-2
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus . Human β-defensin-2 can be used for the study of colitis .
|
- HY-P5158
-
|
Adrenergic Receptor
|
Others
|
Conopeptide rho-TIA is a peptide derived from the venom contained in the predatory sea snail Conus tulipa, has highly selective and noncompetitive inhibitor at human α1B-Adrenergic Receptor. Conopeptide rho-TIA acts a competitive inhibitor at human α1A-Adrenergic Receptor and α1D-Adrenergic Receptor. Conopeptide rho-TIA binds to each subtype and may provide useful information for the development of novel α1-Adrenergic Receptor subtype-selective drugs .
|
- HY-P5807
-
β-Mammal toxin Cn2
|
Sodium Channel
|
Neurological Disease
|
Cn2 toxin is aβ- toxoins. Cn2 toxin can bind to the voltage
sensing domain of voltage gated sodium channels (Nav)
.
|
- HY-P1275
-
- HY-108814
-
DX-88
|
Kallikrein
|
Cardiovascular Disease
|
Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema .
|
- HY-P5942
-
- HY-P4732
-
|
Peptides
|
Others
|
5-FAM-Amylin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3282
-
|
Guanylate Cyclase
|
Metabolic Disease
|
MM 419447, a linaclotide metabolite, is a guanylate cyclase-C agonist. MM 419447 has the potential for the research of the irritable bowel syndrome with constipation (IBS-C) .
|
- HY-P1681
-
|
Sodium Channel
|
Neurological Disease
|
GpTx-1 is a peptide-based NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. GpTx-1 demonstrates potent inhibitory activity against the NaV1.7 channel with an IC50 value of 10 nM, while exhibiting excellent selectivity for NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM), showing >20-fold and >950-fold selectivity respectively .
|
- HY-P5871
-
JzTx-XII
|
Potassium Channel
|
Others
|
Jingzhaotoxin-XII (JzTx-XII) is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII interacts with the channels by modifying the gating behavior .
|
- HY-P5800
-
μ-TrTx-Phlo1b
|
Sodium Channel
|
Neurological Disease
|
Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
- HY-P5783
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can be used for the Dravet syndrome (DS) research .
|
- HY-P4370
-
|
Bacterial
Fungal
|
Infection
|
Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains .
|
- HY-P5846
-
MT3
|
mAChR
Adrenergic Receptor
|
Neurological Disease
|
Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D,α2A,α2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity .
|
- HY-P5865
-
Theraphotoxin-Tap1a; TRTX-Tap1a; µ/ω-TRTX-Tap1a
|
Sodium Channel
|
Neurological Disease
|
Tap1a (Theraphotoxin-Tap1a) is a spider venom peptide that inhibits sodium channels with IC50s of 80 nM and 301 nM against Nav1.7 and Nav1.1, respectively. Tap1a shows analgesic effects .
|
- HY-P5157
-
|
Potassium Channel
|
Neurological Disease
|
BmP02 is a selective Kv1.3 channel blocker and a highly-selective Kv4.2 modulator, which can be isolated from Chinese scorpion (Buthus martensi Karsch) venom. BmP02 also delays the inactivation of Kv4.2 in HEK293T cells, with an EC50 value of ~850 nM. BmP02 inhibits the transient outward potassium currents (Ito) in ventricular muscle cells .
|
- HY-P5649
-
|
Bacterial
|
Infection
|
PhD3 is an antimicrobial peptide derived from monkey white blood cells. PhD3 has activity against bacteria and fungus Candida albicans .
|
- HY-P4373
-
|
Cathepsin
MMP
|
Metabolic Disease
|
Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation .
|
- HY-P5625
-
|
Bacterial
|
Infection
|
ROAD-1 is an oral mucosal α-defensin of Rhesus Macaque. ROAD-1 is active against S. aureus, E. coli, and C. albicans .
|
- HY-P5835
-
|
Potassium Channel
|
Neurological Disease
|
δ-Dendrotoxin is a K + channel blocker that can be obtained from the venom of the black mamba snake. δ-Dendrotoxin can be used in the study of neurological diseases .
|
- HY-P4678A
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P2315
-
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
- HY-P1166
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
UFP-803 is a potent urotensin-II receptor (UT) ligand. UFP-803 has lower residual agonist activity, so it may be an important tool for the investigations on the role played by the UT system in physiology and pathology .
|
- HY-P5739
-
|
Bacterial
|
Infection
|
Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family .
|
- HY-P5869
-
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
- HY-P5900
-
m3-HwTx-IV
|
Sodium Channel
|
Neurological Disease
|
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model .
|
- HY-P0083A
-
POR-8 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Ornipressin (POR-8) acetate is a potent vasoconstrictor, hemostatic and renal agent. Ornipressin acetate is a vasopressin agonist specific for the V1 receptor. Ornipressin acetate can be used as a local vasoconstrictor. Ornipressin acetate can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin acetate has antidiuretic activity. Ornipressin acetate decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
- HY-P4562
-
|
Peptides
|
Others
|
(D-Phe7)-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1166A
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
UFP-803 TFA is a potent urotensin-II receptor (UT) ligand. UFP-803 TFA has lower residual agonist activity, so it may be an important tool for the investigations on the role played by the UT system in physiology and pathology .
|
- HY-P5159A
-
|
Sodium Channel
|
Inflammation/Immunology
|
Crotamine TFA is a Na + channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom .
|
- HY-P5163
-
|
Peptides
|
Inflammation/Immunology
|
NMB-1 is a conopeptide analogue. NMB-1 selectively inhibits sustained mechanically activated currents in sensory neurons (IC50: 1 μM). NMB-1 inhibits mechanical pain. NMB-1 can be used for research of hearing and pressure-evoked pain .
|
- HY-P5142
-
ω-ACTX-Hv1; ω-Atracotoxin-HV1
|
Calcium Channel
|
Neurological Disease
|
ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a blocks voltage-gated calcium channels .
|
- HY-108814A
-
DX-88 TFA
|
Kallikrein
|
Cardiovascular Disease
|
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema .
|
- HY-P5801
-
μ-TrTx-Phlo1a
|
Sodium Channel
|
Neurological Disease
|
Phlo1a (μ-TrTx-Phlo1a) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1a has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
- HY-P5871A
-
JzTx-XII TFA
|
Potassium Channel
|
Others
|
Jingzhaotoxin-XII (JzTx-XII) TFA is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII TFA interacts with the channels by modifying the gating behavior .
|
- HY-P4373A
-
|
Cathepsin
MMP
|
Inflammation/Immunology
|
Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA facilitates osteoclast differentiation .
|
- HY-P4010
-
|
Vasopressin Receptor
|
Others
|
Desamino(D-3-(3′-pyridyl)-Ala2,Arg8)-Vasopressin, a synthetic analog of vasopressin (AVP), is a weak agonist at antidiuretic receptor. However, Desamino(D-3-(3′-pyridyl)-Ala2,Arg8)-Vasopressin is a potent agonist at pituitary corticotrope receptor .
|
- HY-P5156
-
|
Potassium Channel
|
Neurological Disease
|
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death .
|
- HY-P5807A
-
β-Mammal toxin Cn2 TFA
|
Sodium Channel
|
Neurological Disease
|
Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6 .
|
- HY-P5872
-
JZTX-XI
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin XI (JZTX-XI) is a sodium conductance inhibitor with an IC50 of 124 nM. Jingzhaotoxin XI slows the fast inactivation (EC50=1.18±0.2 μM) of Nav1.5 expressed in Chinese hamster ovary (CHO-K1) cells .
|
- HY-P4929
-
|
Peptides
|
Others
|
Biotinyl-(Gln1)-Orexin A (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P2695
-
|
Peptides
|
Infection
|
STh, an Escherichia coli heat-stable toxin, is a 19 amino acid polypeptide encompassing three disulfide bridges. STh is an antigen of interest in the search for a broad coverage enterotoxigenic Escherichia coli (ETEC) vaccine .
|
- HY-P0173A
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
- HY-P5860
-
Micrurotoxin 1
|
GABA Receptor
|
Neurological Disease
|
MmTx1 toxin (Micrurotoxin 1) is an allosteric GABAA receptor modulator that increases GABAA receptor susceptibility to agonist .
|
- HY-P5160A
-
PhlTx1 TFA
|
Sodium Channel
|
Neurological Disease
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
- HY-P1604A
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II TFA is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II TFA causes delayed inactivation of the Na +
|
- HY-P1411A
-
PcTx1 TFA; Psalmopoeus cambridgei toxin-1 TFA
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
Psalmotoxin 1 (PcTx1) TFA is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 TFA is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 TFA can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 TFA can be used in the research of cancers, or neurological disease .
|
- HY-P1409
-
|
Potassium Channel
|
Inflammation/Immunology
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
- HY-P5177
-
- HY-P2496
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P1139
-
PCFWKTCK
|
GHSR
|
Metabolic Disease
|
Cortistatin-8 (CST-8; PCFWKTCK), a neuropeptide, is a GHS-R1a antagonist by counteracting the response of ghrelin on gastric acid secretion. Cortistatin-8 can modulate GH release from somatotroph cells. Cortistatin-8 is a synthetic CST-analogue devoid of any binding affinity to SST-R but capable to bind the GHS-R1a. Cortistatin-8 can exert antagonistic effects on ghrelin actions either in vitro or in vivo in animals .
|
- HY-P5167
-
|
Peptides
|
Inflammation/Immunology
|
GsAF-1 is a peptide toxin containing three disulfide bonds. GsAF-1 can be isolated from the venom of the Chilean pink tarantula. GsAF-1 can be used for research of moderate-to-severe pain .
|
- HY-P5921
-
TsTx-Kα
|
Potassium Channel
|
Neurological Disease
|
Tityustoxin-Kα (TsTx-Kα) is an inhibitor of potassium voltage-gated channels. Tityustoxin-Kα shows a dose-dependent block of the sustained outward current in cultured hippocampal neurons .
|
- HY-P2031
-
|
Arp2/3 Complex
|
Others
|
Phallacidin is a member of the phallotoxin family of mushroom toxins. Phallacidin binds F-actin .
|
- HY-P5179
-
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
- HY-P1216A
-
|
Melanocortin Receptor
|
Neurological Disease
|
HS014 TFA is a potent and selective melanocortin-4 (MC4) receptor antagonist, with Kis of 3.16, 108, 54.4 and 694 nM for human MC4, MC1, MC3 and MC5 receptors respectively. HS014 TFA increases food intake in free-feeding rats .
|
- HY-P3111
-
|
Potassium Channel
|
Others
|
Slotoxin, a peptide from Centruroides noxius Hoffmann scorpion venom, blocks high conductance calcium-activated potassium channel, with Kd of 1.5 nM[1].
|
- HY-19870
-
- HY-P1411
-
PcTx1; Psalmopoeus cambridgei toxin-1
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease .
|
- HY-P1264
-
|
nAChR
|
Neurological Disease
|
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM .
|
- HY-P3065
-
|
Calcium Channel
|
Neurological Disease
|
Calcicludine is a protein toxin from the venom of the green mamba that inhibits high-voltage-activated calcium channel, especially L-type calcium channel .
|
- HY-P1216
-
|
Melanocortin Receptor
|
Neurological Disease
|
HS014 is a potent and selective melanocortin-4 (MC4) receptor antagonist, with Kis of 3.16, 108, 54.4 and 694 nM for human MC4, MC1, MC3 and MC5 receptors, respectively. HS014 modulates the behavioral effects of morphine in mice. HS014 increases food intake in free-feeding rats .
|
- HY-P1424
-
|
Potassium Channel
|
Neurological Disease
|
Lei-Dab7 is a potent and selective SK2 (KCa2.2) channels blocker with a Kd of 3.8 nM. Lei-Dab7 shows low or no activity on KCa1, KCa3, Kv and Kir2.1 channels .
|
- HY-P5160
-
PhlTx1
|
Sodium Channel
|
Neurological Disease
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
- HY-P5183
-
|
Sodium Channel
|
Neurological Disease
|
Hm1a is a disulfide-rich spider-venom peptide, and a NaV1.1 activator. Hm1a restores the function of inhibitory interneurons in Dravet syndrome (DS) mouse model .
|
- HY-P3071
-
Stichodactyla helianthus neurotoxin
|
Potassium Channel
|
Inflammation/Immunology
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
- HY-106224
-
Hypocretin-1 (human, rat, mouse)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)), a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A (human, rat, mouse) has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
- HY-P0173B
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker . Anti-cancer activity .
|
- HY-P5868
-
|
Sodium Channel
|
Neurological Disease
|
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages .
|
- HY-P1219
-
β-TRTX-Cj1α
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-III is a potent and selective blocker of Nav1.5 channels, with an IC50 of 348 nM, and shows no effect on other sodium channel isoforms. Jingzhaotoxin-III can selectively inhibit the activation of cardiac sodium channel but not neuronal subtypes, and hopefully represents an important ligand for discriminating cardiac VGSC subtype .
|
- HY-P1604
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na +
|
- HY-106224A
-
Hypocretin-1 (human, rat, mouse) (TFA)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)) TFA, a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) TFA binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A (human, rat, mouse) TFA has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) TFA is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
- HY-P3213
-
- HY-P1410
-
GsMTx4
Maximum Cited Publications
70 Publications Verification
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
- HY-P5010
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
- HY-P1390
-
|
Vasopressin Receptor
|
Endocrinology
|
d[Cha4]-AVP is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
- HY-P5854
-
|
Potassium Channel
|
Neurological Disease
|
Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases .
|
- HY-P5857
-
Micrurotoxin 2
|
GABA Receptor
|
Neurological Disease
|
MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain .
|
- HY-P10924
-
|
Elastase
|
Metabolic Disease
|
Roseltide rT1 is a neutrophil elastase inhibitor (IC50=0.47 μM) rich in cysteine and one of the Roseltide (rT1-rT8) family members. Roseltide rT1 improves cAMP accumulation stimulated by neutrophil elastase in vitro, showing potential for inhibiting related diseases .
|
- HY-P5681
-
|
Bacterial
|
Infection
Inflammation/Immunology
|
Human α-Defensin 6, a 32-residue cysteine-rich peptide, can inhibit bacterial invasion and contribute to the mucosal immunity. Human α-Defensin 6 forms ordered self-assembly fibrils and nanonets that surround and entangle bacteria after stochastic binding to bacterial surface proteins. Human α-Defensin 6 also inhibits C. albicans biofilm formation .
|
- HY-P3462
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .
|
- HY-P3479
-
- HY-106224B
-
Hypocretin-1 (human, rat, mouse) acetate
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (Hypocretin-1) (human, rat, mouse) acetate is a hypothalamic neuropeptide with analgesic properties (crosses the blood-brain barrier). Orexin A (human, rat, mouse) acetate binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A (human, rat, mouse) acetate can be used in studies of appetite regulation, neurodegenerative diseases and modulation of injurious messaging .
|
- HY-P5164
-
|
Sodium Channel
|
Neurological Disease
|
GrTx1 is a peptide toxin originally isolated from the venom of the spider Grammostola rosea. GrTx1 blocks sodium channel, with IC50s of 0.63 μM, 0.23 μM, 0.77 μM, 1.29 μM, 0.63 μM and 0.37 μM for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7, repectively . GrTx1 can be used for neurological disease research .
|
- HY-P2656
-
hBD-4
|
Bacterial
|
Infection
|
β-Defensin-4 human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity .
|
- HY-P3462A
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .
|
- HY-103277A
-
|
Bombesin Receptor
|
Neurological Disease
Metabolic Disease
|
BIM 23042 TFA, a certain somatostatin (SS) octapeptide analogue, is a selective neuropeptide neuromedin B receptor (NMB-R, BB1) antagonist. BIM 23042 has 100-fold lower affinity for gastrin-releasing peptide (GRP) receptor (BB2). BIM 23042 inhibits Neuromedin B (HY-P0241), ICI 216140 and DPDM-bombesin ethylamide-induced Ca 2+ release .
|
- HY-P1410A
-
GsMTx4 TFA
Maximum Cited Publications
70 Publications Verification
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
GsMTx4 TFA is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 TFA also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 TFA is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
- HY-P1409A
-
|
Potassium Channel
|
Inflammation/Immunology
|
ADWX 1 TFA is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 TFA ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 TFA can be used to study T cell-mediated autoimmune diseases .
|
- HY-103277
-
|
Bombesin Receptor
|
Neurological Disease
Metabolic Disease
|
BIM 23042, a certain somatostatin (SS) octapeptide analogue, is a selective neuropeptide neuromedin B receptor (NMB-R, BB1) antagonist. BIM 23042 has 100-fold lower affinity for gastrin-releasing peptide (GRP) receptor (BB2). BIM 23042 inhibits Neuromedin B (HY-P0241), ICI 216140 and DPDM-bombesin ethylamide-induced Ca 2+ release .
|
- HY-P0090S
-
Salmon calcitonin-13C6,15N4 TFA
|
CGRP Receptor
|
Metabolic Disease
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
- HY-17584A
-
|
Guanylate Cyclase
|
Cancer
|
Linaclotide acetate is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation.
|
- HY-P5916
-
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
|
Peptides
Potassium Channel
|
Neurological Disease
|
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
|
- HY-P1108A
-
|
CFTR
|
Others
|
Astressin 2B TFA is a potent and selective corticotropin-releasing factor receptor 2 (CRF2) antagonist, with the IC50 values of 1.3 nM and > 500 nM for CRF2 and CRF1, respectively. Astressin 2B TFA antagonizes CRF2-mediated inhibition of gastric emptying .
|
- HY-P1108
-
|
CFTR
|
Others
|
Astressin 2B is a potent and selective corticotropin-releasing factor receptor 2 (CRF2) antagonist, with the IC50 values of 1.3 nM and > 500 nM for CRF2 and CRF1, respectively. Astressin 2B antagonizes CRF2-mediated inhibition of gastric emptying .
|
- HY-P10014
-
- HY-P1329
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP is a potent and highly selective μ-opioid receptor antagonist. CTOP antagonizes the acute morphine-induced analgesic effect and hypermotility. CTOP enhances extracellular dopamine levels in the nucleus accumbens. CTOP dose-dependently enhances locomotor activity .
|
- HY-P5154
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P3350
-
|
Bacterial
|
Infection
|
LS-BF1 is a stable and low toxic cationic antimicrobial peptide. LS-BF1 displays broad spectrum of antibacterial activity, including the challenging ESKAPE pathogens, by cell membrane disruptive mechanism. LS-BF1 shows good in vivo efficacy for elimination of bacteria in a mouse infection model[1].
|
- HY-P5172
-
|
Sodium Channel
|
Neurological Disease
|
MitTx-alpha is a subunit of MitTx. MitTx is a potent, persistent, and selective agonist for acid-sensing ion channels (ASICs). MitTx is highly selective for the ASIC1 subtype at neutral pH; under more acidic conditions (pH<6.5), MitTx massively potentiates (>100-fold) proton-evoked activation of ASIC2a channels .
|
- HY-P10239
-
|
Somatostatin Receptor
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
Tyr3-Octreotate is a somatostatin analog. Tyr3-Octreotate exhibits high uptake into tumor, that is capable to be labeled with radioactive metal and thus exhibits antitumor efficacy. Tyr3-Octreotate can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
- HY-P5184
-
HNTX-IV
|
Sodium Channel
|
Neurological Disease
|
Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif .
|
- HY-P10837
-
|
LAG-3
|
Inflammation/Immunology
Cancer
|
LAG-3 cyclic peptide inhibitor 12 (Cyclic peptide 12) is an inhibitor of LAG-3 with an IC50 value of 4.45 μM and a Ki value of 2.66 µM .
|
- HY-P2785A
-
- HY-P1410B
-
- HY-P2588
-
- HY-P5154A
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P5459
-
|
Bacterial
Elastase
|
Infection
|
Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3 in lung. Elafin is antibiotic against Pseudomonas aeruginosa and Staphylococcus aureus .
|
- HY-P3494
-
|
Endogenous Metabolite
|
Metabolic Disease
|
Hepcidin-25 (human) is an iron metabolism modulator. Hepcidin-25 (human) shows anti-inflammatory and anti-bacterial activity via modulation of iron-mediated oxidant injury .
|
- HY-P0028
-
|
Fluorescent Dye
|
Others
|
Phalloidin is a mushroom-derived toxin which can be used to label F-actin of the cytoskeleton with fluorochrome
.
|
- HY-P1410C
-
|
Piezo Channel
Calcium Channel
mTOR
PI3K
Akt
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
D-GsMTx4 TFA is a spider peptide and the D enantiomer of GsMTx4 (HY-P1410). D-GsMTx4 TFA inhibits the mechanosensitive ion channel Piezo2. D-GsMTx4 TFA inhibits [Ca 2+]i elevation. D-GsMTx4 TFA inhibits mTOR and PI3K-Akt signaling pathways. D-GsMTx4 TFA inhibits mechanical allodynia and thermal hyperalgesia. D-GsMTx4 TFA can be used in researches of mechanical stress, chronic pain and idiopathic pulmonary fibrosis .
|
- HY-P10332
-
|
Peptides
|
Others
|
WL 47 dimer (ligand 1) is a caveolin-1 (CAV-1) ligand with high affinity, selectivity and oligomer dissociation activity. WL 47 dimer simultaneously occupies two binding sites of CAV-1, inducing the dissociation of oligomers. WL 47 dimer has 7500-fold improved affinity compared to its T20 parent ligand and an 80% decrease in sequence length. WL 47 dimer can be used to permit targeted study of CAV-1 function .
|
- HY-P2786A
-
- HY-P1426
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K + current (Ki: 131 nM) .
|
- HY-P5180
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
- HY-P3507
-
ShK-186
|
Potassium Channel
|
Metabolic Disease
Inflammation/Immunology
|
Dalazatide (ShK-186) is a specific Kv1.3 potassium channel peptide inhibitor. Dalazatide can be used in the study of autoimmune diseases such as multiple sclerosis (MS), lupus erythematosus, psoriasis, rheumatoid arthritis, type 1 diabetes and inflammatory bowel disease .
|
- HY-106244A
-
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
DOTATATE acetate is a DOTA-conjugated peptide. DOTATATE acetate can be labelled with radionuclides for positron emission tomography (PET) imaging and peptide receptor radionuclide research (PRRT) . DOTATATE (acetate) can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
- HY-106244
-
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
DOTATATE is a DOTA-conjugated peptide. DOTATATE can be labelled with radionuclides for positron emission tomography (PET) imaging and peptide receptor radionuclide research (PRRT) . DOTATATE can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
- HY-P0191
-
- HY-P3546
-
- HY-P10239A
-
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
Tyr3-Octreotate acetate is a somatostatin analog. Tyr3-Octreotate acetate exhibits high uptake into tumor, that is capable to be labeled with radioactive metal and thus exhibits antitumor efficacy. Tyr3-Octreotate acetate can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
- HY-P1329A
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP TFA is a potent and highly selective μ-opioid receptor antagonist. CTOP TFA antagonizes the acute analgesic effect and hypermotility. CTOP TFA enhances extracellular dopamine levels in the nucleus accumbens. CTOP TFA dose-dependently enhances locomotor activity .
|
- HY-P5626
-
|
Bacterial
|
Infection
|
Seabream hepcidin is an antimicrobial peptide with anti-bacterial (V.anguillarum), fungal (S.cerevisiae) and viral hemorrhagic septicemia virus activity .
|
- HY-P3507A
-
ShK-186 TFA
|
Potassium Channel
|
Metabolic Disease
Inflammation/Immunology
|
Dalazatide (ShK-186) TFA is a specific Kv1.3 potassium channel peptide inhibitor. Dalazatide TFA can be used in the study of autoimmune diseases such as multiple sclerosis (MS), lupus erythematosus, psoriasis, rheumatoid arthritis, type 1 diabetes and inflammatory bowel disease .
|
- HY-P5944
-
|
Peptides
|
Others
|
Deamino-pterinotoxin-1 is a peptide toxin synthesized from the deamination of pterinotoxin-1 (HY-5943) .
|
- HY-P1213
-
|
Melanocortin Receptor
|
Neurological Disease
|
JKC363, a selective melanocortin MC4 receptor antagonist, has a 90-fold higher affinity at the MC4 receptor (IC50=0.5 nM) than at the MC3 receptor (44.9 nM). JKC-363 blocks the stimulatory effect of α-MSH on TRH release. Anti-hyperalgesic effect .
|
- HY-P5153
-
μ-TRTX-Tp1a
|
Sodium Channel
|
Neurological Disease
|
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia .
|
- HY-P3064
-
Leiurotoxin I
|
Potassium Channel
|
Neurological Disease
|
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo .
|
- HY-P11071
-
|
PCSK9
|
Cardiovascular Disease
|
PCSK9 Inhibitor, EGF-A is a PCSK9 inhibitor. PCSK9 Inhibitor, EGF-A is residues 293-334 of the EGF-A domain of the low-density lipoprotein (LDL) receptor. PCSK9 Inhibitor, EGF-A can prevent PCSK9-induced intracellular LDLR degradation. PCSK9 Inhibitor, EGF-A can be used in the study of hypercholesterolemia and premature atherosclerosis .
|
- HY-P10126
-
|
Endogenous Metabolite
|
Others
|
Osteocalcin, bovine is a vitamin K-dependent bone specific protein. Osteocalcin, bovine is also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP). Osteocalcin, bovine is a small (49-amino-acid) noncollagenous protein hormone .
|
- HY-P4742A
-
6-FAM-AEEAC-SHK TFA
|
Biochemical Assay Reagents
Potassium Channel
|
Neurological Disease
|
6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) TFA (6-FAM-AEEAC-SHK TFA) is a peptide neurotoxin conjugated with a fluorescent marker. 6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) TFA can block voltage-gated potassium channels (kv1.1 and kv1.2) to prolong the duration of action potentials, thereby affecting the conduction of neural signals. 6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) TFA can be used in neuroscience research .
|
- HY-P4742
-
6-FAM-AEEAC-SHK
|
Biochemical Assay Reagents
|
Others
|
6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) (6-FAM-AEEAC-SHK) is a polypeptide that can be used as a Biochemical Assay Reagents.
|
- HY-P1213A
-
|
Melanocortin Receptor
|
Neurological Disease
|
JKC363 TFA, a selective melanocortin MC4 receptor antagonist, has a 90-fold higher affinity at the MC4 receptor (IC50=0.5 nM) than at the MC3 receptor (44.9 nM). JKC363 TFA blocks the stimulatory effect of α-MSH on TRH release. Anti-hyperalgesic effect .
|
- HY-P10046
-
|
Vasopressin Receptor
|
Metabolic Disease
|
[Deamino-Pen1,Val4,D-Arg8]-vasopressin (AVP-A) is an arginine-vasopressin (AVP) antagonist. AVP-A can significantly lower plasma aldosterone concentration in rats. AVP-A can be used for the research of the growth and steroidogenic capacity of rat adrenal zona glomerulosa .
|
- HY-P0191A
-
- HY-P1188
-
|
Integrin
|
Cancer
|
LDV-FITC, a fluorescent peptide, is a FITC-conjugated LDV peptide (HY-P2267). LDV-FITC binds to the α4β1 integrin with high affinity (Kd: 0.3 nM and 12 nM for binding to U937 cells in the presence and absence of Mn 2+ respectively). LDV-FITC can be used to detect α4β1 integrin affinity .
|
- HY-P5155
-
|
Potassium Channel
|
Neurological Disease
|
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats .
|
- HY-P10860
-
|
Factor Xa
|
Cardiovascular Disease
|
cMCoFx1 is a potent and selective FXIIa cyclic peptide inhibitor. cMCoFx1 has high binding affinity (KD: 900 pM) and inhibitory activity (Ki: 370 pM) for FXIIa. cMCoFx1 can effectively inhibit endogenous clotting pathways, and cMCoFx1 is stable in serum and non-cytotoxic .
|
- HY-P1188A
-
|
Integrin
|
Cancer
|
LDV-FITC TFA, a fluorescent peptide, is a FITC-conjugated LDV peptide (HY-P2267). LDV-FITC TFA binds to the α4β1 integrin with high affinity (Kd: 0.3 nM and 12 nM for binding to U937 cells in the presence and absence of Mn 2+ respectively). LDV-FITC TFA can be used to detect α4β1 integrin affinity .
|
- HY-P2785
-
- HY-106216
-
|
Elastase
|
Infection
Inflammation/Immunology
|
Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease .
|
- HY-P1959A
-
BIM 23014 acetate
|
Somatostatin Receptor
|
Endocrinology
Cancer
|
Lanreotide (BIM 23014) acetate is a somatostatin analogue with antineoplastic activity. Lanreotide acetate can be used for the research of carcinoid syndrome .
|
- HY-P1264F
-
|
nAChR
|
Neurological Disease
|
α-Bungarotoxin, FITC labeledis the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
- HY-P1215
-
|
Melanocortin Receptor
|
Metabolic Disease
|
HS024 is a selective MC4 receptor antagonist, with Kis of 0.29, 3.29, 5.45, and 18.6 nM for MC4, MC5, MC3, and MC1, respectively. HS024 increase food intake .
|
- HY-108055
-
|
Urotensin Receptor
Peptides
|
Cardiovascular Disease
|
Urantide is a selective and competitive urotensin-II (UT) receptor antagonist peptide (pKB=8.3) that blocks human urotensin-II (hU-II)-induced contractions in rat thoracic aorta ex vivo. Urantide can be used to study the (patho)physiological role of hU-II in the mammalian cardiovascular system .
|
- HY-P5085
-
|
Peptides
|
Others
|
Acetyl-octreotide is a reduced linear peptide. Acetyl-octreotide can synthesize Re(V)-cyclized peptides in aqueous methanol solutions with low Sst receptor binding affinities .
|
- HY-P5176
-
LtTx-1a
|
Peptides
|
Neurological Disease
|
Latartoxin-1a (LtTx-1a) is a peptide toxin can be isolated from L. tarabaevi. Latartoxin-1a is paralytic and lethal to insects and has membrane-bound activity .
|
- HY-P1959
-
- HY-P3955
-
- HY-P1408A
-
|
Integrin
|
Cancer
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
- HY-P5151
-
|
Peptides
|
Others
|
LiTx3 is a lethal and cysteine-rich peptide. LiTx3 can be isolated from L. intermedia crude venom. LiTx3 induces flaccid paralysis in Spodoptera frugiperda larvae .
|
- HY-P0036B
-
SMS 201-995 pamoate
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) pamoate is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide pamoate can bind to the somatostatin receptors which are mainly subtypes 2, 3 and 5. Octreotide pamoate increases Gi activity and reduces intracellular cAMP production. Octreotide pamoate has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
- HY-P1442
-
|
Adrenergic Receptor
|
Cancer
|
AdTx1 is a selective α1A-adrenoceptor antagonist (Ki: 0.35 nM). AdTx1 can be used for research of benign prostatic hyperplasia .
|
- HY-103048A
-
|
PD-1/PD-L1
|
Cancer
|
PD-1/PD-L1-IN 3 TFA, a macrocyclic peptide, is a potent and selective inhibitor of the PD-1/PD-L1 and CD80/PD-L1 interactions extracted from patent WO2014151634A1, compound No.1. PD-1/PD-L1-IN 3 TFA interferes with PD-L1 binding to PD-1 and CD80 by binding to PD-L1, with IC50s of 5.60 nM and 7.04 nM, respectively. PD-1/PD-L1-IN 3 TFA can be used for the research of various diseases, including cancer and infectious diseases .
|
- HY-P1285
-
Con-R
|
iGluR
|
Neurological Disease
|
Conantokin R (Con-R) is an NMDA receptor peptide antagonist with an IC50 of 93 nM. Conantokin R binds Zn 2+ and Mg 2+ with Kds of 0.15 μM and 6.5 μM, respectively. Conantokin R shows anticonvulsant activity .
|
- HY-P4372
-
|
Peptides
|
Others
|
Hepcidin-22 (human) is an inactive degradation product of hepcidin-25 that is present in the urine .
|
- HY-P0036
-
SMS 201-995
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide (SMS 201-995) can bind to the somatostatin receptor and mainly subtypes 2, 3, and 5, increases Gi activity, and reduces intracellular cAMP production. Octreotide (SMS 201-995) has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
- HY-P3143
-
|
PD-1/PD-L1
|
Cancer
|
BMSpep-57 is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 facilitates T cell function by in creasing IL-2 production in PBMCs .
|
- HY-P3499
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Dolcanatide is an orally active GC-C (guanylate cyclase-C) agonist. Dolcanatide shows laxative, anti-nociceptive and anti-inflammatory activity. Dolcanatide can be used in inflammatory bowel disease research .
|
- HY-P1408
-
|
Integrin
|
Cancer
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
- HY-P10693
-
- HY-P0061
-
- HY-P1215A
-
|
Melanocortin Receptor
|
Metabolic Disease
|
HS024 is a selective MC4 receptor antagonist, with Kis of 0.29, 3.29, 5.45, 18.6 nM for MC4, MC5, MC3, and MC1, respectively. HS024 increase food intake .
|
- HY-P2014
-
- HY-P10920
-
|
Drug Derivative
|
Cancer
|
DOTAMTATE is a somatostatin analogue. DOTAMTATE marked 212Pb is promising for research of somatostatin receptor positive neuroendocrine tumors .
|
- HY-P10572
-
- HY-P2026
-
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
|
A 71915 is a highly potent and competitive natriuretic peptide receptor A (ANP, NPRA) antagonist (pKi= 9.18). A 71915 displaces [ 125I]ANP dose dependently, with a Ki of 0.65 nM. A71915( pA2= 9.48) against rat ANP-induced cGMP production in NB-OK-1 cells .
|
- HY-P1980
-
|
Apoptosis
|
Metabolic Disease
|
A-71915 (TFA) is a selective inhibitor of ANP receptor (atrial natriuretic peptide-receptor), induces apoptosis and decreases insulin secretion in RINm5F pancreatic β-cells .
|
- HY-P5140
-
|
Calcium Channel
|
Metabolic Disease
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
- HY-P4925
-
|
Peptides
|
Others
|
Biotinyl-(Arg8)-Vasopressin is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5175
-
|
mAChR
|
Neurological Disease
|
Muscarinic toxin 7 is a peptide toxin with selective and noncompetitive antagonism at the muscarinic M1 receptor .
|
- HY-P3143A
-
|
PD-1/PD-L1
|
Cancer
|
BMSpep-57 hydrochloride is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 hydrochloride binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 hydrochloride facilitates T cell function by in creasing IL-2 production in PBMCs .
|
- HY-P0061B
-
RC160 diacetate; BMY 41606 diacetate
|
Neurokinin Receptor
|
Cancer
|
Vapreotide diacetate is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM.
|
- HY-P0061A
-
RC-160 acetate; BMY-41606 acetate
|
Neurokinin Receptor
|
Cancer
|
Vapreotide acetate (RC-160 acetate; BMY-41606 acetate) is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM.
|
- HY-P1959B
-
BIM 23014 diTFA
|
Somatostatin Receptor
|
Endocrinology
Cancer
|
Lanreotide (BIM 23014) diTFA is a somatostatin analogue with antineoplastic activity. Lanreotide diTFA can be used for the research of carcinoid syndrome .
|
- HY-P5162
-
|
Sodium Channel
|
Inflammation/Immunology
|
Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities .
|
- HY-P5144
-
- HY-P5152
-
|
Sodium Channel
|
Neurological Disease
|
Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials .
|
- HY-P1335
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
- HY-P5833
-
κ-Bgt
|
nAChR
|
Neurological Disease
|
κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM .
|
- HY-P10230
-
|
Bacterial
|
Infection
|
Sublancin is an antimicrobial peptide, which inhibits DNA replication, transcription and translation, without affecting membrane integrity. Sublancin suppresses glucose uptake for the competition of phosphotransferase system (PTS). Sublancin inhibits B. subtilis strain 168 ΔSPβ with MIC of 0.312 μM .
|
- HY-P2592
-
- HY-P1330
-
|
P2X Receptor
|
Inflammation/Immunology
|
Purotoxin 1 is a P2X3 receptor inhibitor. Purotoxin 1 shows antinociceptive properties in animal models of inflammatory pain. Purotoxin 1 can be isolated from the venom of the wolf spider Geolycosa sp .
|
- HY-P10273A
-
|
Radionuclide-Drug Conjugates (RDCs)
Biochemical Assay Reagents
|
Cancer
|
DOTA-Octreotide TFA is composed of chelator DOTA and Octreotide (HY-P0036). DOTA-Octreotide TFA is used for research of cancer through combination with radioactive elements. DOTA-Octreotide TFA can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
- HY-P1426A
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA is specific blocker of Kv4 channel. AmmTX3 TFA inhibits the A-type K + current (Ki: 131 nM) .
|
- HY-P5917
-
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
Vm24-toxin (Vaejovis mexicanus peptide 24), a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
- HY-P5182A
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
- HY-P0178A
-
|
Integrin
|
Inflammation/Immunology
|
LXW7 TFA, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 TFA increases phosphorylation of VEGFR-2 and activation of ERK1/2. Anti-inflammatory effect .
|
- HY-P5568
-
RP 71955
|
HIV
|
Infection
|
RP 71955 is an antimicrobial peptide against HIV-1 .
|
- HY-P5165
-
|
Potassium Channel
|
Inflammation/Immunology
|
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K + current with an IC50 of 2 nM .
|
- HY-P1335A
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP TFA is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP TFA displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP TFA can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
- HY-P4764
-
|
Melanocortin Receptor
|
Cardiovascular Disease
|
Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 is a cyclic octapeptide with MC4R agonism. Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 significantly increases heart rate and blood pressure .
|
- HY-P4897
-
- HY-P5920
-
- HY-P5917A
-
Vaejovis mexicanus peptide 24 TFA
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
Vm24-toxin (Vaejovis mexicanus peptide 24) TFA, a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin TFA shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin TFA folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin TFA attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
- HY-P10273
-
- HY-P0178
-
|
Integrin
|
Inflammation/Immunology
|
LXW7, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 increases phosphorylation of VEGFR-2 and activation of ERK1/2. Anti-inflammatory effect .
|
- HY-P5182
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
- HY-P1443
-
|
Sodium Channel
|
Cancer
|
OD1 is a scorpion α-toxin that can be isolated from the venom of the Iranian yellow scorpion (Odonthobuthus doriae. OD1 is a modulator of mammalian Nav1.7 (EC50: 4.5 nM) .
|
- HY-P1726A
-
|
Melanocortin Receptor
|
Cancer
|
MSG606 TFA is a potent human MC1 receptor antagonist (IC50=17 nM). MSG606 TFA also partial agonist at human MC3 and MC5 receptors (EC50 values are 59 and 1300 nM, respectively). MSG606 TFA exhibits binding affinity for A375 melanoma cells in vitro. MSG606 TFA reverses the induced hyperalgesia in female mice, with no effect in male mice.
|
- HY-P5931
-
Potassium channel toxin alpha-KTx 6.13; SPX; α-KTx6.13
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers .
|
- HY-P5174
-
|
Sodium Channel
|
Neurological Disease
|
MitTx is a complex formed by MitTx-α and MitTx-β. MitTx is an ASIC1 channel activator with EC50 values of 9.4 and 23 nM for ASIC1a and ASIC1b isoforms, respectively. MitTx is highly selective for ASIC1 isoforms at neutral pH. Under acidic conditions, MitTx greatly enhances proton-evoked ASIC2a channel activation .
|
- HY-P4521
-
|
MMP
|
Others
|
Ac-Pro-Leu-Gly-[(S)-2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OEt is a MMP12 substrate, and can be used to detect MMP12 enzyme activity .
|
- HY-P1102
-
TC14012
3 Publications Verification
|
CXCR
HIV
|
Infection
Cancer
|
TC14012, a serum-stable derivative of T140, is a selective and peptidomimetic CXCR4 antagonist with an IC50 of 19.3 nM. TC14012 is a potent CXCR7 agonist with an EC50 of 350 nM for recruiting β-arrestin 2 to CXCR7. TC14012 has anti-HIV activity and anti-cancer activity .
|
- HY-P4745
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
hMCH-1R antagonist 1 (Compound 30) is an effective and selective antagonist of human melanin-concentrating hormone receptor 1 (hMCHR1) with an KB value of 3.6 nM. HMCH-1R antagonist 1 can bind to hMCHR1 and hMCHR2 with IC50 values of 65 nM and 49 nM, respectively. HMCH-1R antagonistist 1 can be used for metabolic research .
|
- HY-P2005
-
|
Reactive Oxygen Species (ROS)
SOD
|
Others
|
Malformin C is an algicidal peptide can be isolated from Aspergillus and exhibits dose-dependent algicidal activity. Malformin C induces a significant increase in ROS levels in algal cells, resulting in impaired SOD activity and high production of MDA content .
|
- HY-P1102A
-
|
CXCR
HIV
|
Infection
Cancer
|
TC14012 TFA, a serum-stable derivative of T140, is a selective and peptidomimetic CXCR4 antagonist with an IC50 of 19.3 nM. TC14012 TFA is a potent CXCR7 agonist with an EC50 of 350 nM for recruiting β-arrestin 2 to CXCR7. TC14012 TFA has anti-HIV activity and anti-cancer activity .
|
- HY-P1682A
-
POL6326 TFA
|
CXCR
Arrestin
|
Cancer
|
Balixafortide TFA (POL6326 TFA) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide TFA shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide TFA blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide TFA is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
- HY-P2112
-
DOTA-Nal3-octreotide
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Others
|
DOTA-NOC (DOTA-Nal3-octreotide) is a high-affinity ligand of somatostatin receptor subtypes 2, 3 and 5. DOTA-NOC can be used for labeling with various radiometals, and development of radiopeptide imaging . DOTA-NOC can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
- HY-P1682
-
POL6326
|
CXCR
Arrestin
|
Cancer
|
Balixafortide (POL6326) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
- HY-17572A
-
- HY-P4397
-
|
Oxytocin Receptor
|
Endocrinology
|
(d(CH2)51,Tyr(Me)2,Thr4,Orn8,des-Gly-NH29)-Vasotocin, an oxytocin receptor antagonist, abolishes oxytocin-enhanced inhibitory postsynaptic currents in CA1 pyramidal neurons .
|
- HY-P4555
-
|
Somatostatin Receptor
|
Neurological Disease
|
(D-Phe5,Cys6,11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide (Compound 4) is a somatostatin analog with Kds of 0.61, 11.05, 23.5, 1200 and >1000 nM for SSTR5, SSTR3, SSTR2, SSTR1 and SSTR4, respectively .
|
- HY-P3561A
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P5954
-
|
Calcium Channel
|
Others
|
PLTX-II is a calcium channel blocker. PLTX-II has a 44-residue peptide containing ten Cys residues and an O-palmitoylated threonine amide at the carboxy-terminus .
|
- HY-P5006
-
d(CH2)5[Tyr(Me)2, Dab5]AVP
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(d(CH2)51,Tyr(Me)2,Dab5,Arg8)-Vasopressin (d(CH2)5[Tyr(Me)2, Dab5]AVP) is a specific antagonist of vasopressin V1a receptor, with a pA2 of 6.71 .
|
- HY-P2244A
-
|
YAP
|
Cancer
|
YAP-TEAD-IN-1 TFA is a potent and competitive peptide inhibitor of YAP-TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 TFA is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd= 40 nM) .
|
- HY-P3561
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P4398
-
|
Peptides
|
Others
|
(Cys(Acm)6,12)-Orexin A (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-108719
-
|
Insulin Receptor
Akt
|
Metabolic Disease
Cancer
|
Insulin glargine is a long-acting insulin analog. Insulin glargine has the effect of lowering blood sugar and can be used in the research of diabetes. In addition, high doses of Insulin glargine can promote the proliferation of bladder cancer cells .
|
- HY-131374
-
|
CXCR
|
Cancer
|
TN14003 is a CXCR4 inhibitor. TN14003 has antitumor activity .
|
- HY-P2244
-
|
YAP
|
Cancer
|
YAP-TEAD-IN-1 is a potent and competitive inhibitor of?YAP–TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd=40 nM) .
|
- HY-P3215A
-
|
Oxytocin Receptor
|
Endocrinology
|
Oxytocin parallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P10698
-
|
Peptide-Drug Conjugates (PDCs)
LDLR
|
Neurological Disease
|
VH-N412 is a vectorized neuropeptide (NT) with good blood-brain barrier permeability. VH-N412 binds to the low-density lipoprotein receptor (LDLR) and neuropeptide receptor 1 (NTSR-1), and acts as a pharmacological-induced hypothermia (PIH) inducer. VH-N412 exhibits anticonvulsant and neuroprotective effects, and can be used in the study of neurological diseases such as epilepsy.
|
- HY-P4980
-
|
Peptides
|
Others
|
Acetyl-Lys5-octreotide is a biologically active peptide .
|
- HY-P3222A
-
|
Peptides
|
Endocrinology
|
Oxytocin antiparallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P4957
-
|
Somatostatin Receptor
|
Others
|
Octreotide dimer parallel is a dimer parallel of Octreotide. Octreotide (HY-P0036) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue .
|
- HY-P3222
-
|
Peptides
|
Endocrinology
|
Oxytocin antiparallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P3215
-
|
Oxytocin Receptor
|
Endocrinology
|
Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P1717A
-
Cp40 TFA
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 TFA (Cp40 TFA), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 (Cp40) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
- HY-P1717B
-
Cp40 acetate
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 acetate (Cp40 acetate), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 acetate (Cp40 acetate) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
- HY-P10378
-
|
GnRH Receptor
|
Metabolic Disease
|
GPR10 agonist 1 (compound 18-S4) is a potent GPR10 agonist with EC50 values of 80, 7.8 nM in the presence (10%) or absence (0%) of FBS, respectively. GPR10 agonist 1 has the potential for the research of chronic obesity .
|
- HY-P1717
-
Cp40
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 (Cp40), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 (Cp40) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
- HY-P1162
-
- HY-125628
-
|
Endogenous Metabolite
|
Infection
|
Kahalalide A is an anti-mycobacterial compound with antimicrobial activity. Kahalalide A is derived from the marine mollusk Elysia rufescens. Kahalalide A has attracted extensive attention in natural product research due to its potential medicinal value .
|
- HY-P4469
-
- HY-P2434
-
|
Somatostatin Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC50: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .
|
- HY-P3124
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190, a somatostatin analog, a selective SSTR2 and SSTR5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
- HY-P3124A
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190 hydrochloride, a somatostatin analog, a selective SSRT2 and SSRT5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
- HY-P10204
-
|
Wnt
|
Cancer
|
FZD7 antagonist 1 (peptide 34) is a dFz7-21 analogue. FZD7 antagonist 1 is an FZD7 antagonist that inhibits the wnt3a with IC50 value of 9.2 nM. FZD7 antagonist 1 blocks TcdB−FZD interaction via targeting FZD receptors .
|
- HY-P10563
-
BHV-1100
|
CD38
|
Cancer
|
Noraramtide (BHV-1100) is an antibody recruitment molecule. Noraramtide can specifically bind to CD38 molecules to recruit natural killer (NK) cells. Noraramtide enhances the ability of NK cells to kill tumor cells through antibody-dependent cellular cytotoxicity (ADCC). This mechanism allows NK cells to more effectively recognize and eliminate tumor cells while avoiding mutual killing between NK cells. Noraramtide can be used for the study of autologous cancer immunity .
|
- HY-P0171
-
BKT140 (4-fluorobenzoyl); BL-8040; TF14016
|
CXCR
|
Endocrinology
Cancer
|
Motixafortide (BKT140 4-fluorobenzoyl) is a novel CXCR4 antagonist with an IC50 vakue of ~1 nM.
|
- HY-P4895
-
|
Oxytocin Receptor
|
Neurological Disease
|
(d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin (OVT) is an oxytocin receptor antagonist. (d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin can be used for the research of neurological disease .
|
- HY-A0248A
-
|
Bacterial
|
Infection
|
Polymyxin B1 is a potent antimicrobial lipopeptide first derived from Bacilus polymyxa. Polymyxin B1 is the major component in Polymyxin B (HY-A0248). Polymyxin B1 can induce lysis of bacterial cells through interaction with their membranes. Polymyxin B1 has the potential for multidrug-resistant Gram-negative bacterial infections treatment .
|
- HY-P10934
-
LXY2
|
Integrin
|
Cancer
|
LXY3 (LXY2) is a VLA-3-blocking peptide that inhibits the interaction between integrin α3β1 (VLA-3) on neutrophil surfaces and laminin in the basement membrane, thereby preventing neutrophil migration across the tumor vascular basement membrane barrier. LXY3 is used to block neutrophil-mediated nanoparticle release from perivascular pools into the tumor interstitium. LXY3 is commonly employed for targeted imaging of breast cancer .
|
- HY-P4890A
-
- HY-P5362A
-
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 TFA can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 TFA is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas. NODAGA-LM3 TFA can be labeled with [68Ga] for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
- HY-P5362
-
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas. NODAGA-LM3 can be labeled with [68Ga] for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
- HY-P4452
-
- HY-P4890
-
- HY-P0041A
-
- HY-P1955
-
Velcalcetide; AMG 416; KAI-4169
|
CaSR
|
Metabolic Disease
|
Etelcalcetide (AMG 416; KAI-4169) is a synthetic calcimimetic as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis, which is promising for research in the field of secondary hyperparathyroidism and chronic kidney disease .
|
- HY-P0041
-
- HY-105168
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
TAK 044 is an antagonist of Endothelin Receptor. TAK 044 strongly inhibits ET-induced deterioration in various animal models. TAK 044 can be used in study ET-related diseases such as acute myocardial infarction,acute renal failure, acute hepatic malfunction, and subarachnoid hemorrhage .
|
- HY-17365
-
- HY-P3432
-
|
Biochemical Assay Reagents
|
Others
|
DfTat is a dimer of the prototypical cell-penetrating peptide TAT. DfTat can deliver small molecules, peptides and proteins into live cells with a particularly high efficiency. DfTat labeled with the rhodamine can be used as a tracer for easy detection .
|
- HY-105055
-
|
Peptides
|
Cancer
|
Didemnin B is a depsipeptide extracted from the marine tunicate Trididemnin cyanophorum. Didemnin B can be used for the research of cancer .
|
- HY-P4903
-
|
Peptides
|
Cancer
|
RGD-targeted Proapoptotic Peptide is a peptide. The C-terminal RGD-4C peptide (ACDCRGDCFC) binds preferentially to integrins at sites of tumor angiogenesis.
|
- HY-P0003A
-
Brain Natriuretic Peptide-32 human acetate; BNP-32 acetate
|
Natriuretic Peptide Receptor (NPR)
Calcium Channel
|
Cardiovascular Disease
|
Nesiritide (Brain Natriuretic Peptide-32 human) acetate is a recombinant human B-type natriuretic peptide. Nesiritide acetate is a NPRs agonist, with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide acetate regulates V1/2 activation/inactivation of the L-type calcium channel. Nesiritide acetate shows vasodilatory, diuretic, and natriuretic activities. Nesiritide acetate is used in cardiovascular diseases such as heart failure and vascular remodeling after arterial injury .
|
- HY-P10964
-
|
GHSR
|
Endocrinology
|
Tezusomant is a growth hormone receptor antagonist. Tezusomant is promising for research of diseases such as acromegaly caused by excessive growth hormone secretion .
|
Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
Cat. No. |
Product Name |
Chemical Structure |
-
- HY-P0090S
-
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
-
Cat. No. |
Product Name |
|
Classification |
-
- HY-P10758
-
|
|
Alkynes
|
Alkyne-βAG-TOCA, an octreotide derivative, targets somatostatin receptor type 2 (SST2) . Alkyne-βAG-TOCA can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: