1. Metabolic Enzyme/Protease Membrane Transporter/Ion Channel
  2. Ser/Thr Protease Potassium Channel
  3. HG1 Toxin

HG1 Toxin is a peptide found in the venom of the scorpion Heterometrus fulvipes, which has the activity of inhibiting potassium channel Kv1.3. HG1 Toxin also has the activity of inhibiting trypsin (Ki=107 nM) and can be used in the study of autoimmune diseases.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

HG1 Toxin

HG1 Toxin Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

HG1 Toxin is a peptide found in the venom of the scorpion Heterometrus fulvipes, which has the activity of inhibiting potassium channel Kv1.3. HG1 Toxin also has the activity of inhibiting trypsin (Ki=107 nM) and can be used in the study of autoimmune diseases[1].

Molecular Weight

7741.62

Formula

C337H503N103O97S6

Sequence

Gly-His-His-Asn-Arg-Val-Asn-Cys-Leu-Leu-Pro-Pro-Lys-Thr-Gly-Pro-Cys-Lys-Gly-Ser-Phe-Ala-Arg-Tyr-Tyr-Phe-Asp-Ile-Glu-Thr-Gly-Ser-Cys-Lys-Ala-Phe-Ile-Tyr-Gly-Gly-Cys-Glu-Gly-Asn-Ser-Asn-{Asn(GlcNAc)}-Phe-Ser-Glu-Lys-His-His-Cys-Glu-Lys-Arg-Cys-Arg-Gly-Phe-Arg-Lys-Phe-Gly-Gly-Lys (disulfide bridge: Cys8-Cys58;Cys17-Cys54;Cys33-Cys41)

Sequence Shortening

GHHNRVNCLLPPKTGPCKGSFARYYFDIETGSCKAFIYGGCEGNSN-{Asn(GlcNAc)}-FSEKHHCEKRCRGFRKFGGK (disulfide bridge: Cys8-Cys58;Cys17-Cys54;Cys33-Cys41)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HG1 Toxin
Cat. No.:
HY-P10572
Quantity:
MCE Japan Authorized Agent: