Nesiritide acetate  (Synonyms: Brain Natriuretic Peptide-32 human acetate; BNP-32 acetate)

Nesiritide (Brain Natriuretic Peptide-32 human) acetate is a recombinant human B-type natriuretic peptide. Nesiritide acetate is a NPRs agonist, with K_d values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide acetate regulates V_1/2 activation/inactivation of the L-type calcium channel. Nesiritide acetate shows vasodilatory, diuretic, and natriuretic activities. Nesiritide acetate is used in cardiovascular diseases such as heart failure and vascular remodeling after arterial injury^{[1][2][3][4][5][6][7]}.

Nesiritide (1 nM-1 μM) acetate significantly decreases cell shortening in ventricular myocytes isolated from rat hearts in a dose-dependent manner^[1].
Nesiritide (1 μM) acetate increases the V_1/2 activation of the L-type calcium channel by 51.1% and decreases V_{1/2 inactivation by 31.8% in ventricular myocytes isolated from rat hearts^[1].}

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Nesiritide (2 μg/kg i.v. bolus followed by 0.01 μg/kg/min i.v. infusion) acetate reduces infarct size, preserves endothelial function, and lessens lung edema in a porcine model of acute coronary occlusion simulating urgent CABG surgery^[2].
Nesiritide (0.1 mg/kg/day; s.c.; once daily; 4 weeks) acetate protects endothelial function after balloon-induced trauma in the iliac artery in rabbits^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3524.09

C₁₄₅H₂₄₈N₅₀O₄₄S₄

1684439-46-0

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys10-Cys26)

Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge: Cys10-Cys26)

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Sodi R, et al. B-type natriuretic peptide (BNP) attenuates the L-type calcium current and regulates ventricular myocyte function. Regul Pept. 2008 Nov 29;151(1-3):95-105.  [Content Brief]

  [2]. Lazar HL, et al. Nesiritide enhances myocardial protection during the revascularization of acutely ischemic myocardium. J Card Surg. 2009 Sep-Oct;24(5):600-5.  [Content Brief]

  [3]. Liu S Q, et al. Nesiritide protects endothelial function after balloon-induced trauma in the iliac artery in rabbits. Brazilian Journal of Pharmaceutical Sciences, 2020, 56: e18430.

  [4]. Liu SQ, et al. Treatment with nesiritide, a recombinant B-type natriuretic Peptide, reduces vascular remodeling following balloon-induced endothelial injuries in rabbits. Tohoku J Exp Med. 2010 Nov;222(3):219-23.  [Content Brief]

  [5]. Liu SQ, et al. Recombinant B-type natriuretic peptide nesiritide attenuates vascular remodelling by reducing plasma aldosterone in rabbits. Heart Lung Circ. 2012 Sep;21(9):551-5.  [Content Brief]

  [6]. Hobbs RE, et al. Therapeutic potential of nesiritide (recombinant b-type natriuretic peptide) in the treatment of heart failure. Expert Opin Investig Drugs. 1999 Jul;8(7):1063-72.  [Content Brief]

  [7]. Koller KJ, et al. Molecular biology of the natriuretic peptides and their receptors. Circulation. 1992 Oct;86(4):1081-8.  [Content Brief]