1. GPCR/G Protein Neuronal Signaling
  2. Adrenergic Receptor mAChR
  3. Muscarinic toxin 3

Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D2A2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Muscarinic toxin 3

Muscarinic toxin 3 Chemical Structure

CAS No. : 873336-87-9

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All Adrenergic Receptor Isoform Specific Products:

View All mAChR Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D2A2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity[1].

IC50 & Target

pIC50: 8.79 (M4 mAChR), 6.71 (M1 mAChR), 8.86 (α1A-adrenoceptor), 8.49 (α2A-adrenoceptor), 8.13 (α1D-adrenoceptor), 7.57 (α1B-adrenoceptor), 7.29 (α2C-adrenoceptor), <6.5 (α2B-adrenoceptor)[1]

Molecular Weight

7379.35

Formula

C319H489N89O97S8

CAS No.
Sequence

Leu-Thr-Cys-Val-Thr-Lys-Asn-Thr-Ile-Phe-Gly-Ile-Thr-Thr-Glu-Asn-Cys-Pro-Ala-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Arg-Trp-His-Tyr-Val-Ile-Pro-Arg-Tyr-Thr-Glu-Ile-Thr-Arg-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ile-Pro-Glu-Asn-Tyr-Asp-Ser-Ile-His-Cys-Cys-Lys-Thr-Asp-Lys-Cys-Asn-Glu (Disulfide bridge: Cys3-Cys24,Cys17-Cys42,Cys46-Cys57,Cys58-Cys63)

Sequence Shortening

LTCVTKNTIFGITTENCPAGQNLCFKRWHYVIPRYTEITRGCAATCPIPENYDSIHCCKTDKCNE (Disulfide bridge: Cys3-Cys24,Cys17-Cys42,Cys46-Cys57,Cys58-Cys63)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Muscarinic toxin 3
Cat. No.:
HY-P5846
Quantity:
MCE Japan Authorized Agent: