1. Peptides
  2. Peptide and Derivatives
  3. Pramlintide acetate hydrate

Pramlintide acetate hydrate is the acetate hydrate of Pramlintide (HY-P0058). Pramlintide acetate hydrate can be used for the stufy of type 1 and type 2 diabetes.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Pramlintide acetate hydrate

Pramlintide acetate hydrate Chemical Structure

CAS No. : 196078-30-5

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Pramlintide acetate hydrate:

Other Forms of Pramlintide acetate hydrate:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Pramlintide acetate hydrate is the acetate hydrate of Pramlintide (HY-P0058). Pramlintide acetate hydrate can be used for the stufy of type 1 and type 2 diabetes[1].

Molecular Weight

3949.39 (free base)

Formula

C171H267N51O53S2.xC2H4O2·xH2O

CAS No.
Sequence

Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (disulfide bridge:Cys2-Cys7)

Sequence Shortening

KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (disulfide bridge:Cys2-Cys7)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Pramlintide acetate hydrate Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pramlintide acetate hydrate
Cat. No.:
HY-109552
Quantity:
MCE Japan Authorized Agent: