1. GPCR/G Protein
  2. Amylin Receptor
  3. NN1213 acetate

NN1213 acetate (Peptide 21), a long-acting human amylin peptide analog, is a selective Amylin receptor agonist with an EC50 of 0.177 and 0.262 nM for hAMY3R and rAMY3R, respectively. NN1213 acetate significantly reduces appetite in rat and dog models. NN1213 acetate can be used for antiobesity research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

NN1213 acetate

NN1213 acetate Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of NN1213 acetate:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

NN1213 acetate (Peptide 21), a long-acting human amylin peptide analog, is a selective Amylin receptor agonist with an EC50 of 0.177 and 0.262 nM for hAMY3R and rAMY3R, respectively. NN1213 acetate significantly reduces appetite in rat and dog models. NN1213 acetate can be used for antiobesity research[1].

Molecular Weight

4553.10 (free base)

Formula

C198H316N56O63S2.xC2H4O2

Sequence

{Lys(γGlu-γGlu-C20 diacid)}-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asp-Phe-Leu-Arg-His-Ser-Ser-Pro-Asn-Phe-Gly-Ala-Ile-Pro-Ser-Ser-Thr-Asn-Val-Gly-Ser-Arg-Thr-Tyr-NH2 (disulfide bridge:Cys2-Cys7)

Sequence Shortening

{Lys(γGlu-γGlu-C20 diacid)}-CNTATCATQRLADFLRHSSPNFGAIPSSTNVGSRTY-NH2 (disulfide bridge:Cys2-Cys7)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NN1213 acetate
Cat. No.:
HY-P11245A
Quantity:
MCE Japan Authorized Agent: