Adropin (34-76) (human, mouse, rat)

Name: Adropin (34-76) (human, mouse, rat)
Brand: MedChemExpress
SKU: HY-P4860
Rating: 4.5 (1 reviews)

Cat. No.: HY-P4860 Purity: 98.23%: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adropin (34-76) (human, mouse, rat) Chemical Structure

CAS No. : 1802086-30-1

Size	Stock	Quantity
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	In-stock	Estimated Time of Arrival: December 31
50 mg	Get quote
100 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Akt Isoform Specific Products:

View All Isoforms

Akt Akt1 Akt2 Akt3

View All JNK Isoform Specific Products:

View All Isoforms

JNK1 JNK2 JNK3 JNK

View All PKA Isoform Specific Products:

View All Isoforms

PKA PKAR PKACα

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

Adropin (34-76) (100 nM; 3 h) inhibits glucose production in primary cultured mouse hepatocytes^[1].
Adropin (34-76) (100 nM; 3 h) decreases cAMP levels in HepG2 hepatocytes^[1].
Adropin (34-76) (0-100 ng/mL; 48 h) inhibits TGF-β-induced cell activation, collagen production and fibrotic remodeling in fibroblasts^[2].
Adropin (34-76) (100 ng/mL; 48 h) plays an anti-fibrotic role in fibroblasts by inhibiting the GLI1 signaling pathway^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis ^[2]

Cell Line:	TGF-β treated fibroblasts
Concentration:	0, 10, 50 and 100 ng/mL
Incubation Time:	48 h
Result:	Reduced the levels of α-smooth muscle actin and type І collagen in a dose-dependent manner.

Immunofluorescence ^[2]

Cell Line:	TGF-β treated fibroblasts
Concentration:	100 ng/mL
Incubation Time:	48 h
Result:	Reduced GLI1 and GLI2 staining intensity but did not interfere with the nuclear translocation of GLI1 or GLI2.

In Vivo

Adropin (34-76) (450 nmol/kg ≈ 2 mg/kg; intraperitoneal injection; 5 injections within 48 hours) has a hypoglycemic effect in a diet-induced obesity model of mice^[1].
Adropin (34-76) (10 μg/kg/h; subcutaneous osmotic pump; 25 days) has an improved effect in the mouse model of fibrosis^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Male DIO B6 mice^[1]
Dosage:	450 nmol/kg ≈ 2 mg/kg
Administration:	Five intraperitoneal injections over a 48-h period
Result:	Enhanced intracellular signaling actions underlying insulin’s effect on hepatic glucose metabolism. Alleviated hepatic ER stress responses. Diminished JNK and PKA signaling in the liver. Down-regulates hepatic lipogenic genes. Altered the phosphorylation levels of IP3R in the liver.

Animal Model:	Mouse with fibrosis model^[2]
Dosage:	10 μg/kg/h
Administration:	Subcutaneous osmotic pump; 25 days
Result:	Ameliorated allogeneic bone marrow transplantation (alloBMT)-induced skin fibrosis, with reduced dermal thickness, lower myofibroblast counts, and decreased hydroxyproline content. Ameliorated alloBMT-induced pulmonary fibrosis, with reduced Ashcroft scores and hydroxyproline content.

Molecular Weight

4499.82

Formula

C₁₉₀H₂₉₃N₅₅O₆₈S₂

CAS No.

1802086-30-1

Appearance

Solid

Color

White to off-white

Sequence

Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro (Disulfide bridge: Cys1-Cys23)

Sequence Shortening

CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP (Disulfide bridge: Cys1-Cys23)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility

In Vitro:

DMSO : 50 mg/mL (11.11 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2222 mL	1.1112 mL	2.2223 mL
5 mM	0.0444 mL	0.2222 mL	0.4445 mL
10 mM	0.0222 mL	0.1111 mL	0.2222 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo:

Select the appropriate dissolution method based on your experimental animal and administration route.

For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for in vivo experiments, it is recommended to prepare freshly and use it on the same day.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

Protocol 1

Add each solvent one by one: 10% DMSO 40% PEG300 5% Tween-80 45% Saline
Solubility: ≥ 2.5 mg/mL (0.56 mM); Clear solution

This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown).
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 400 μL PEG300, and mix evenly; then add 50 μL Tween-80 and mix evenly; then add 450 μL Saline to adjust the volume to 1 mL.
Preparation of Saline: Dissolve 0.9 g sodium chloride in ddH₂O and dilute to 100 mL to obtain a clear Saline solution.
Protocol 2

Add each solvent one by one: 10% DMSO 90% (20% SBE-β-CD in Saline)
Solubility: ≥ 2.5 mg/mL (0.56 mM); Clear solution

This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown).
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 900 μL 20% SBE-β-CD in Saline, and mix evenly.
Preparation of 20% SBE-β-CD in Saline (4°C, storage for one week): 2 g SBE-β-CD powder is dissolved in 10 mL Saline, completely dissolve until clear.

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Please enter your animal formula composition:

DMSO +

Tween-80 +

Saline

Recommended: Keep the proportion of DMSO in working solution below 2% if your animal is weak.

The co-solvents required include: DMSO, . All of co-solvents are available by MedChemExpress (MCE). , Tween 80. All of co-solvents are available by MedChemExpress (MCE).

Calculation results:

Working solution concentration: mg/mL

Method for preparing stock solution: mg drug dissolved in μL DMSO (Stock solution concentration: mg/mL).

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only. If necessary, please contact MedChemExpress (MCE).

Method for preparing in vivo working solution for animal experiments: Take μL DMSO stock solution, add μL . μL , mix evenly, next add μL Tween 80, mix evenly, then add μL Saline.

If the continuous dosing period exceeds half a month, please choose this protocol carefully.

Please ensure that the stock solution in the first step is dissolved to a clear state, and add co-solvents in sequence. You can use ultrasonic heating (ultrasonic cleaner, recommended frequency 20-40 kHz), vortexing, etc. to assist dissolution.

Purity & Documentation

Purity: 98.23%

Select Batch:

Data Sheet (275 KB) SDS (252 KB)

COA (242 KB) RP-HPLC (112 KB) MS (227 KB)

Handling Instructions (2659 KB)

References

[1]. Gao S, et al. The peptide hormone adropin regulates signal transduction pathways controlling hepatic glucose metabolism in a mouse model of diet-induced obesity. J Biol Chem. 2019 Sep 6;294(36):13366-13377. [Content Brief]

[2]. Liang M, et al. Attenuation of fibroblast activation and fibrosis by adropin in systemic sclerosis. Sci Transl Med. 2024 Mar 27;16(740):eadd6570. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

DMSO	1 mM	0.2222 mL	1.1112 mL	2.2223 mL	5.5558 mL
	5 mM	0.0444 mL	0.2222 mL	0.4445 mL	1.1112 mL
	10 mM	0.0222 mL	0.1111 mL	0.2222 mL	0.5556 mL