Search Result

Pathways Recommended:	Metabolic Enzyme/Protease

Results for "

angiotensin-converting enzyme (ACE)

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Angiotensin Receptor (9) Angiotensin-converting Enzyme (ACE) (204) 11β-HSD (3) Acetyl-CoA Carboxylase (1) ADAMTS (1) Adenosine Receptor (1) Adrenergic Receptor (1) Akt (6) Aminopeptidase (1) AMPK (1) Apoptosis (24) Autophagy (4) Bradykinin Receptor (1) c-Met/HGFR (1) Calcium Channel (1) Casein Kinase (3) Caspase (2) CDK (1) Cholinesterase (ChE) (1) DGK (1) DNA/RNA Synthesis (1) Dopamine Receptor (1) Drug Metabolite (14) Endogenous Metabolite (14) ERK (2) HSV (1) IKK (1) Influenza Virus (2) Interleukin Related (3) Isotope-Labeled Compounds (27) Keap1-Nrf2 (1) mAChR (3) Mitochondrial Metabolism (2) MMP (9) mTOR (1) Neprilysin (8) NF-κB (6) NO Synthase (1) NOD-like Receptor (NLR) (1) Opioid Receptor (1) Oxidative Phosphorylation (1) p38 MAPK (2) Parasite (3) Peptide-Drug Conjugates (PDCs) (1) Phosphatase (1) PI3K (1) PKC (1) Reactive Oxygen Species (ROS) (7) Reference Standards (31) SARS-CoV (8) Sirtuin (3) Src (1) STAT (3) TNF Receptor (2) Toll-like Receptor (TLR) (2) Xanthine Oxidase (1)
By Research Areas:	Cancer (32) Cardiovascular Disease (186) Endocrinology (5) Infection (12) Inflammation/Immunology (24) Metabolic Disease (23) Neurological Disease (13)

By Targets:

Angiotensin Receptor (9)

Angiotensin-converting Enzyme (ACE) (204)

11β-HSD (3)

Acetyl-CoA Carboxylase (1)

ADAMTS (1)

Adenosine Receptor (1)

Adrenergic Receptor (1)

Akt (6)

Aminopeptidase (1)

AMPK (1)

Apoptosis (24)

Autophagy (4)

Bradykinin Receptor (1)

c-Met/HGFR (1)

Calcium Channel (1)

Casein Kinase (3)

Caspase (2)

CDK (1)

Cholinesterase (ChE) (1)

DGK (1)

DNA/RNA Synthesis (1)

Dopamine Receptor (1)

Drug Metabolite (14)

Endogenous Metabolite (14)

ERK (2)

HSV (1)

IKK (1)

Influenza Virus (2)

Interleukin Related (3)

Isotope-Labeled Compounds (27)

Keap1-Nrf2 (1)

mAChR (3)

Mitochondrial Metabolism (2)

MMP (9)

mTOR (1)

Neprilysin (8)

NF-κB (6)

NO Synthase (1)

NOD-like Receptor (NLR) (1)

Opioid Receptor (1)

Oxidative Phosphorylation (1)

p38 MAPK (2)

Parasite (3)

Peptide-Drug Conjugates (PDCs) (1)

Phosphatase (1)

PI3K (1)

PKC (1)

Reactive Oxygen Species (ROS) (7)

Reference Standards (31)

SARS-CoV (8)

Sirtuin (3)

Src (1)

STAT (3)

TNF Receptor (2)

Toll-like Receptor (TLR) (2)

Xanthine Oxidase (1)

By Research Areas:

Cancer (32)

Cardiovascular Disease (186)

Endocrinology (5)

Infection (12)

Inflammation/Immunology (24)

Metabolic Disease (23)

Neurological Disease (13)

241

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Peptides

Inhibitory Antibodies

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Vicenin 3	Angiotensin-converting Enzyme (ACE) ERK MMP ADAMTS p38 MAPK	Cardiovascular Disease
Vicenin 3 is an **angiotensin-converting enzyme** (ACE) inhibitor (IC₅₀ = 46.91 μM) that can be isolated from the aerial parts of Desmodium styracifolium. Vicenin 3 ameliorates IL-1β-induced extracellular matrix degradation in SW1353 chondrocytes by regulating the MAPK pathway. Vicenin 3 can be used for the study of osteoarthritis (OA) and hypertension .

Delapril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases .

Ramipril 2 Publications Verification HOE-498	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease Cancer
Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

Enalapril maleate 10+ Cited Publications MK-421 maleate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) maleate, the active metabolite of enalapril, is an angiotensin-converting enzyme (ACE) inhibitor.

Utibapril FPL 63547	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Utibapril is an **angiotensin-converting enzyme (ACE)** inhibitor with antihypertensive activities.

Zofenopril	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Zofenopril is an **angiotensin-converting enzyme** (ACE) inhibitor with an IC₅₀ of 81 μM.

Leucylarginylproline	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Leucylarginylproline is an angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 0.27μM.

RXP 407	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RXP 407 is a potent and selective **Angiotensin-converting Enzyme (ACE) inhibitor with a K_i** of 12nM .

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

(+)-Chloroquine	Angiotensin Receptor	Others
(+)-Chloroquine is a aminoquinoline drug impairs in vitro the terminal glycosylation of angiotensin-converting enzyme 2 (ACE-2) .

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

Teprotide SQ-20881	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Metabolic Disease
Teprotide is an inhibitor of **angiotensin-converting enzyme (ACE)** inhibitor. Teprotide can be used to study hypertensive .

Quinapril hydrochloride 3 Publications Verification CI-906	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinapril (hydrochloride) (CI-906) is a proagent that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications.

Vicenin-1	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Vicenin 1 is a C-glycosylflavone that has an inhibitory effect on angiotensin-converting enzyme (ACE)(IC₅₀=52.50 μM) .

RB-105	Neprilysin Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RB-105 is an inhibitor of angiotensin-converting enzyme (ACE) (K_i = 4.2 nM) and neutral endopeptidase (NEP) (K_i = 1.7 nM). RB-105 after inhibiting ACE reduces the production of Ang II and increase the level of bradykinin. RB-105 after inhibiting NEP increases the level of natriuretic peptide and further increases the level of bradykinin, thereby generating a powerful synergistic effect. RB-105 has significant antihypertensive and natriuretic effects in both spontaneously hypertensive rats and normal blood pressure rats. RB-105 can be used for research on hypertension .

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

Abz-Ser-Pro-3-nitro-Tyr	Angiotensin-converting Enzyme (ACE)	Others
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

Fosinopril sodium 3 Publications Verification SQ28555	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril Sodium is the ester prodrug of an **angiotensin-converting enzyme (ACE)** inhibitor, used for the treatment of hypertension and some types of chronic heart failure.

Fasidotril Alatriopril	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Fasidotril is a dual inhibitor of neprilysin and **angiotensin-converting enzyme (ACE)** for the potential research of hypertension and congestive heart failure (CHF).

NCX899	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NCX899 is a NO-releasing derivative of enalapril, and shows inhibitory activity against **angiotensin-converting enzyme (ACE)** activity.

Enalapril 10+ Cited Publications MK-421	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) is an angiotensin-converting enzyme *(ACE)* inhibitor, can be used for hypertensive diseases research .

Enalapril sodium MK-421 sodium	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) sodium is an angiotensin-converting enzyme *(ACE)* inhibitor, can be used for hypertensive diseases research .

Tuna AI	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Tuna AI, an **angiotensin-converting enzyme (ACE) inhibitor, exhibits IC₅₀** values of 1 μM and 2 μM for ACEs from bovine and rabbit lungs, respectively .

Canvircept	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Canvircept is a recombinant fusion protein comprising an angiotensin-converting enzyme 2 (ACE2) fused to a human IgG1 Fc .

Mca-YVADAP-Lys(Dnp)-OH	Caspase Angiotensin-converting Enzyme (ACE)	Others
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

Ro 31-8472	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ro 31-8472 is a Cilazapril (HY-A0043) derivative. Ro 31-8472 is an **angiotensin-converting enzyme (ACE)** inhibitor .

Mca-YVADAP-Lys(Dnp)-OH TFA	Cholinesterase (ChE) Caspase	Others
Mca-YVADAP-Lys(Dnp)-OH TFA is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

Zabicipril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Zabicipril hydrochloride is an orally active angiotensin-converting enzyme (ACE) inhibitor. Zabicipril hydrochloride can be used for the study of blood pressure and peripheral arterial insufficiency .

Zabicipril	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Zabicipril is an orally active angiotensin-converting enzyme (ACE) inhibitor. Zabicipril can be used for the study of blood pressure and peripheral arterial insufficiency .

HOE-288	Angiotensin-converting Enzyme (ACE)	Neurological Disease
HOE-288 is an orally active **angiotensin-converting enzyme** (ACE) inhibitor. HOE-288 can be used for the research of neurological disease .

A-58365B	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
A-58365B is an **Angiotensin-converting Enzyme (ACE)** inhibitor. A-58365B has antihypertensive effects .

RXPA 380	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RXPA 380 is a C-terminal specific angiotensin-converting enzyme (ACE) inhibitor with a K_i of 3 nM. RXPA 380 inhibits C-domain mutants of human recombinant ACE with an IC₅₀ of 2.5 nM .

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent **angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀** of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

Moexipril	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease Neurological Disease
Moexipril is an orally active inhibitor of **angiotensin-converting enzyme** (ACE), and becomes effective by being hydrolyzed to moexiprila (hydrochloride). Moexipril exhibits antihypertensive and neuroprotective effects ^- .

Resorcinolnaphthalein 2 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Inflammation/Immunology
Resorcinolnaphthalein is a specific **angiotensin-converting enzyme 2 (ACE2)** enhancer and activates ACE2 activity with an EC₅₀ value of 19.5 μM. Resorcinolnaphthalein can be used for the investigation of hypertension and renal fibrosis .

H-Ile-Trp-OH Ile-Trp	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Trp-OH (Ile-Trp), a dipeptide, is an **angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀** of 0.7 μM. H-Ile-Trp-OH inhibits predominantly the C-domain of ACE .

FA-Phe-Phe	Angiotensin-converting Enzyme (ACE)	Others
FA-Phe-Phe is a furylacryloyl (fa)-amino acid derivative, targeting to **Angiotensin-converting Enzyme (ACE). FA-Phe-Phe is also a specific substrate of Cathepsin** A .

Ser-Ala-Pro	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ser-Ala-Pro is an X-Pro structure specific **angiotensin-converting enzyme (ACE)** inhibitory peptide. Ser-Ala-Pro has the potential for hypertension research .

Cat. No.	Product Name

HY-L052

Anti-COVID-19 Compound Library

1,450 compounds

COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs.

Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1,450 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.

Cat. No.	Product Name	Type

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly

FAPGG

Fluorescent Dye

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a specific substrate of angiotensin converting enzyme (ACE) with a Ki of 2.546×10 ^-4 M. It is used as a chromogenic probe for quantitative detection of ACE activity. N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly can be hydrolyzed by ACE to generate N-[3-(2-furyl)acryloyl]-Phe (FAP) and Gly-Gly, and the ACE inhibitory effect is monitored by photometry. FAPGG competitively binds to the active center of ACE and is a key tool for screening ACE inhibitors such as Captopril (HY-B0368) and Dioscorin. Its reversible mechanism of action supports hypertension research and drug development targeting the renin-angiotensin system .

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH	Fluorescent Dye
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

Cat. No.	Product Name	Target	Research Area

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-P1488

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

HY-P2616A

Mca-YVADAP-Lys(Dnp)-OH TFA	Cholinesterase (ChE) Caspase	Others
Mca-YVADAP-Lys(Dnp)-OH TFA is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-P4471

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

HY-P2366

Teprotide SQ-20881	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Metabolic Disease
Teprotide is an inhibitor of **angiotensin-converting enzyme (ACE)** inhibitor. Teprotide can be used to study hypertensive .

HY-P4546

Abz-Ser-Pro-3-nitro-Tyr	Angiotensin-converting Enzyme (ACE)	Others
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

HY-P2605

Tuna AI	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Tuna AI, an **angiotensin-converting enzyme (ACE) inhibitor, exhibits IC₅₀** values of 1 μM and 2 μM for ACEs from bovine and rabbit lungs, respectively .

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH	Caspase Angiotensin-converting Enzyme (ACE)	Others
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent **angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀** of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

HY-P4524

FA-Phe-Phe	Angiotensin-converting Enzyme (ACE)	Others
FA-Phe-Phe is a furylacryloyl (fa)-amino acid derivative, targeting to **Angiotensin-converting Enzyme (ACE). FA-Phe-Phe is also a specific substrate of Cathepsin** A .

HY-P10391

Ser-Ala-Pro	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ser-Ala-Pro is an X-Pro structure specific **angiotensin-converting enzyme (ACE)** inhibitory peptide. Ser-Ala-Pro has the potential for hypertension research .

HY-114424A

H-Ile-Pro-Pro-OH hydrochloride 1 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-114424

H-Ile-Pro-Pro-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-P10791

YYLLVR	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
YYLLVR is an angiotensin-converting enzyme (ACE) inhibitory peptide with an inhibitory rate of 89.10%. YYLLVR has a lower binding energy for *ACE* of -35.98 kcal/mol. YYLLVR can be used in the study of hypertensive diseases .

HY-P4279

Ovalbumin (154-159)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ovalbumin (154-159) is a fragment from ovalbumin. Ovalbumin (154-159) is a potent **angiotensin-converting enzyme (ACE)** inhibitor. Ovalbumin (154-159) can be used for research of hypertension .

HY-118060

Dipeptide 2 N-Valyltryptophan; Val-Trp	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Dipeptide 2 (N-Valyltryptophan; Val-Trp) is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient . Dipeptide 2 is an **angiotensin-converting Enzyme (ACE)** .

HY-P1032F

Biotinyl-Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Endocrinology
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the **angiotensin-converting enzyme** (ACE) .

HY-P0318

Hemorphin-7	Opioid Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

HY-P4257

L-Isoleucyl-L-arginine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
L-Isoleucyl-L-arginine is a dipeptide formed from L-isoleucine and L-arginine residues. L-Isoleucyl-L-arginine is a potent **angiotensin-converting enzyme (ACE)** inhibitor. L-Isoleucyl-L-arginine can be used for research of hypertension .

HY-P2619

BPP 5a	Angiotensin Receptor Peptide-Drug Conjugates (PDCs)	Cardiovascular Disease
BPP 5a is a bradykinin-potentiating peptide with vasorelaxant activity, which is found in Bothrops jararaca venom. BPP 5a is an angiotensin-converting enzyme (ACE) inhibitor with a K_i value of 400 nM. BPP 5a is promising for research of hypertension and cardiovascular diseases .

HY-P4281

Ovotransferrin (328-332)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Neurological Disease
Ovotransferrin (328-332) has a protective activity on the blood pressure by inhibiting the **Angiotensin-Converting Enzyme (ACE), with the IC₅₀ of 20 μM. Ovotransferrin (328-332) fragment has an activity against Cholinesterase (ChE)**, implicating in Alzheimer’s diseases .

HY-P1444

Acein	Dopamine Receptor	Neurological Disease
Acein is a novel nonapeptide, H-Pro-Pro-Thr-Thr-Thr-Lys-Phe-Ala-Ala-OH. Acein can promote the release of dopamine. Acein targets angiotensin converting enzyme (ACE I). Angiotensin converting enzyme (ACE I) can be used in nervous system related research .

HY-P10808

RSRGVFF	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RSRGVFF (FOXP3 inhibitor P60) is a mixed-type angiotensin-converting enzyme (ACE) inhibitor with blood-brain barrier permeability, boasting an IC₅₀ value of 5.01 μM . RSRGVFF is capable of binding to both active and non-active sites of *ACE* and its substrate HHL complex, thus reducing the catalytic activity of *ACE*. RSRGVFF can be further utilized for research on lowering hypertension .

HY-P0266B

N-Acetyl-Ser-Asp-Lys-Pro acetate Ac-SDKP acetate	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology
N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate is a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE). N-Acetyl-Ser-Asp-Lys-Pro acetate is a natural inhibitor of pluripotent hematopoietic stem cell proliferation. Anti-inflammatory and antifibrotic properties .

HY-118060R

Dipeptide 2 (Standard)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Dipeptide 2 (Standard) is the analytical standard of Dipeptide 2. This product is intended for research and analytical applications. Dipeptide 2 (N-Valyltryptophan; Val-Trp) is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient . Dipeptide 2 is an angiotensin-converting Enzyme (ACE) .

HY-P4554

H-Phe-Arg-OH	Endogenous Metabolite	Metabolic Disease
H-Phe-Arg-OH is a dipeptide containing phenylalanine and arginine. H-Phe-Arg-OH can be separated from Bradykinin (HY-P0206) through Angiotensin-converting enzyme (ACE, HY-P2983). H-Phe-Arg-OH can be used for metabolic research .

HY-P2072

GF109	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
GF109 is a potent parenteral inhibitor of **angiotensin converting enzyme (ACE)**. GF109 has antihypertensive effects .

HY-P4560

H-Pro-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Pro-Phe-OH is a dipeptide containing proline and phenylalanine, which can serve as a substrate for prolinase. H-Pro-Phe-OH can also be used for polypeptide synthesis, where phenylalanine is an aromatic amino acid that can inhibit the activity of **Angiotensin-converting enzyme** (ACE, HY-P2983) .

HY-P10601

αs1-CN f(143–149)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
αs1-CN f(143–149) is an orally active casein-derived peptide sequence. αs1-CN f(143–149) exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC₅₀=6.58 μM) and antihypertensive activity .

HY-P10601A

αs1-CN f(143–149) acetate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
αs1-CN f(143–149) acetate is an orally active casein-derived peptide sequence. αs1-CN f(143–149) acetate exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC₅₀=6.58 μM) and antihypertensive activity .

HY-P3976

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an **angiotensin-converting Enzyme (ACE)** inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure .

HY-P5774

Leu-Valorphin-Arg	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Leu-Valorphin-Arg (LVV-hemorphin-6), an opioid active peptide, is an **angiotensin converting enzyme (ACE)** inhibitor. Leu-Valorphin-Arg can be used for hypertension research .

HY-P4654

H-Tyr-Lys-OH	Angiotensin-converting Enzyme (ACE)	Others
H-Tyr-Lys-OH is a dipeptide that can be used as a biomarker for AJH-1. H-Tyr-Lys-OH has a good binding affinity to angiotensin converting enzyme (ACE) .

HY-P1829

Angiotensin I/II (1-6)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P1829A

Angiotensin I/II (1-6) (TFA)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P4641

H-Trp-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Trp-Phe-OH is a dipeptide consisting of tryptophan and phenylalanine (Trp-Phe). H-Trp-Phe-OH is also an antihypertensive peptide with inhibitory activity on angiotensin-converting enzyme (ACE), dose-dependently increases NO levels, and decreases endothelin-1 (ET-1) levels. H-Trp-Phe-OH (2 mg/kg; subcutaneous injection; 6 injections over 3 days) causes an increase in ovarian weight in female mice .

HY-P11334

Cyanostatin B	Aminopeptidase Phosphatase Angiotensin-converting Enzyme (ACE) DNA/RNA Synthesis	Cancer
Cyanostatin B, a cyanobacterial lipopeptide, is a leucine aminopeptidase M (LAP) inhibitor (IC₅₀ = 12 ng/mL). Cyanostatin B is a weak inhibitor of protein phosphatase (PP2A) and also exhibits weak inhibitory activity against angiotensin-converting enzyme (ACE), with an IC₅₀ value of 130 μg/mL. Cyanostatin B demonstrates both cytotoxic and genotoxic effects on human hepatocytes, although non-toxic to Artemia salina. Cyanostatin B inhibits the proliferation of HepG2 cells, induces DNA single-strand breaks, and causes genomic instability. .

HY-P1792A

Angiotensin II (1-4), human TFA	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P1792

Angiotensin II (1-4), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly FAPGG	Angiotensin-converting Enzyme (ACE)	Others
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a specific substrate of angiotensin converting enzyme (ACE) with a Ki of 2.546×10 ^-4 M. It is used as a chromogenic probe for quantitative detection of ACE activity. N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly can be hydrolyzed by ACE to generate N-[3-(2-furyl)acryloyl]-Phe (FAP) and Gly-Gly, and the ACE inhibitory effect is monitored by photometry. FAPGG competitively binds to the active center of ACE and is a key tool for screening ACE inhibitors such as Captopril (HY-B0368) and Dioscorin. Its reversible mechanism of action supports hypertension research and drug development targeting the renin-angiotensin system .

HY-P1032S2

Angiotensin I-13C6,15N (human, mouse, rat) TFA	Isotope-Labeled Compounds Endogenous Metabolite	Others
Angiotensin I-13C6,15N (human, mouse, rat) TFA is ¹³C and ¹⁵N labeled Angiotensin I (human, mouse, rat) TFA. Angiotensin I-13C6,15N (human, mouse, rat) TFA is a precursor of angiotensin II and is cleaved into angiotensin II by angiotensin converting enzyme (ACE) .

HY-W011258

H-Tyr-Phe-OH L-Tyrosyl-L-phenylalanine	Xanthine Oxidase Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology Cancer
H-Tyr-Phe-OH (L-Tyrosyl-L-phenylalanine) is an orally active inhibitor of **Angiotensin converting enzyme** (ACE), with an inhibiton rate of 48% at 50 μM. H-Tyr-Phe-OH can be used as an biomarker for differentiating benign thyroid nodules (BTN) from thyroid cancer (TC). H-Tyr-Phe-OH exhibits xanthine oxidase inhibition (uric acid lowering) activity and serves as regulator in IL-8 production in neutrophil-like cells .

HY-P11297

AC-SDKP-NH2	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
AC-SDKP-NH2 is a substrate peptide of **Angiotensin converting enzyme (ACE)**. AC-SDKP-NH2 has anti-inflammatory and anti-fibrotic activities. AC-SDKP-NH2 directly acts on tissues and prevents or reverses them from excessive fibrosis, but fails to reduce blood pressure and left ventricular hypertrophy (LVH). AC-SDKP-NH2 attenuates inflammation and cell differentiation, proliferation and migration, therefore reducing fibrosis in the heart, vessels and kidneys in mice model. AC-SDKP-NH2 can be used for cardiovascular diseases such as hypertension research .

HY-P11358

IRW	Angiotensin-converting Enzyme (ACE) Acetyl-CoA Carboxylase Mitochondrial Metabolism	Inflammation/Immunology
IRW is an orally active tripeptide produced from egg white with **angiotensin converting enzyme** (ACE) inhibitory properties. IRW can prevent high-fat diet (HFD)-induced Non-alcoholic fatty liver disease (NAFLD) by modulating hepatic lipid metabolism and increasing mitochondrial content. IRW decreases hepatic triglyceride content and lipid droplet size. IRW increases the hepatic mitochondrial complexes and citrate synthase activity, phosphorylation of 5’-AMP-activated protein kinase and microsomal triglyceride transfer protein abundance. IRW increases phosphorylated acetyl CoA carboxylase and mitochondrial complexes, IRW can be used for the research of inflammation .

Cat. No.	Product Name	Target	Research Area

HY-P990731

Canvircept	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Canvircept is a recombinant fusion protein comprising an angiotensin-converting enzyme 2 (ACE2) fused to a human IgG1 Fc .

HY-P990814

Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34)	SARS-CoV	Infection
Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34) is a mouse-derived IgG1 κ type antibody inhibitor, targeting to SARS-CoV-2 S protein. Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34) reacts with the receptor binding domain (RBD) epitope B in the spike (S) protein of SARS-CoV-2 (Severe Acute Respiratory Syndrome Coronavirus 2). Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34) can block the binding of the SARS-CoV-2 S protein to angiotensin-converting enzyme 2 (ACE2). Anti-SARS-CoV-2 S protein Antibody (RBD epitope B, SARS2-34) can be used for the research of SARS-CoV-2 infection .

HY-P990815

Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01)	SARS-CoV	Infection
Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01) is a mouse-derived IgG1 κ type antibody inhibitor, targeting to SARS-CoV-2 S protein. Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01) reacts with the receptor binding domain (RBD) epitope A in the spike (S) protein of SARS-CoV-2 (Severe Acute Respiratory Syndrome Coronavirus 2). Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01) can block the binding of the SARS-CoV-2 S protein to angiotensin-converting enzyme 2 (ACE2). Anti-SARS-CoV-2 S protein Antibody (RBD epitope A, SARS2-01) can be used for the research of SARS-CoV-2 infection .

Species:	Human (10) Rhesus Macaque (2) Rat (1) Mouse (2) Cynomolgus (1)
Tag:	His (11) Avi (4) Fc (7)
Source:	HEK293 (15) Sf9 insect cells (2)

Cat. No.	Compare	Product Name	Species	Source

HY-P7443

	ACE2 Protein, Human (HEK293, mFc) 1 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, mFc) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7441

	ACE2 Protein, Human (HEK293, His, solution) 2 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, His, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7442

	ACE2 Protein, Human (HEK293, hFc, solution) 1 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human, (HEK293, Fc, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P70769

	ACE2 Protein, Human (Biotinylated, HEK293, His-Avi) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (Biotinylated, HEK 293, His-Avi) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Human is also an essential regulator of cardiac function and blood pressure control.

HY-P72029

	ACE2 Protein, Cynomolgus (HEK293, hFc) ACE2; angiotensin-converting enzyme	Cynomolgus	HEK293
	ACE2 Protein, Cynomolgus (HEK293, hFc) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 is also an essential regulator of cardiac function and blood pressure control.

HY-P7828

	ACE2 Protein, Rhesus macaque (HEK293, His) rRhangiotensin-converting enzyme/ACE-2, His; angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Rhesus Macaque	HEK293
	ACE2 Protein, Rhesus macaque (HEK 293, His) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Rhesus macaque is also an essential regulator of cardiac function and blood pressure control.

HY-P73489

	ACE2 Protein, Human (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (HEK293, His) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag.

HY-P700445

	ACE2 Protein, Paguma larvata (HEK293, hFc) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Others	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system, converting angiotensin I to anti-hypertrophic angiotensin 1-9 and vasoconstrictor angiotensin II to vasodilator angiotensin 1-7, thereby regulating cardiovascular homeostasis. It can remove the C-terminal residues of vasoactive peptides and cleave a variety of biological peptides. ACE2 Protein, Paguma larvata (HEK293, hFc) is the recombinant ACE2 protein, expressed by HEK293 , with C-hFc labeled tag.

HY-P700455

	ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

HY-P704972

	ACE2 Protein, Human (Biotinylated, 594a.a, HEK293, His-Avi) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293

HY-P72808

	ACE2 Protein, Human (sf9, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (sf9, His) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

HY-P72809

	ACE2 Protein, Rat (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rat	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system that complexly regulates cardiovascular homeostasis. It specifically converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7, exerting antihypertrophic and vasodilatory effects. ACE2 Protein, Rat (HEK293, His) is the recombinant rat-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag.

HY-P74434

	ACE2 Protein, Mouse (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293
	ACE2 protein is an important carboxypeptidase in the renin-angiotensin system, which can regulate blood volume and vascular resistance and maintain cardiovascular homeostasis. It converts angiotensin I to the antihypertrophic angiotensin 1-9 and angiotensin II to the vasodilatory angiotensin 1-7, thereby opposing vasoconstriction. ACE2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ACE2 protein, expressed by HEK293, with C-His labeled tag.

HY-P72810

	ACE2 Protein, Rhesus Macaque (HEK293, Fc) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rhesus Macaque	HEK293
	ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ACE2 protein, expressed by HEK293 , with C-hFc labeled tag.

HY-P74433

	ACE2 Protein, Mouse (HEK293, His-Fc) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293
	ACE2 protein is an important carboxypeptidase in the renin-angiotensin system, which can regulate blood volume and vascular resistance and maintain cardiovascular homeostasis. It converts angiotensin I to the antihypertrophic angiotensin 1-9 and angiotensin II to the vasodilatory angiotensin 1-7, thereby opposing vasoconstriction. ACE2 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived ACE2 protein, expressed by HEK293 , with C-hFc, C-His, C-8*His labeled tag.

HY-P72807

	ACE2 Protein, Human (Biotinylated, sf9, His-Avi) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-Avi, C-His labeled tag.

HY-P704342

	PE-Labeled ACE2 Protein, Human (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. PE-Labeled ACE2 Protein, Human (HEK293, His) is the recombinant human-derived PE-Labeled ACE2 protein, expressed by HEK293, with C-His labeled tag.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Product Name	Chemical Structure

HY-B0231AS

Enalaprilat-d5
Enalaprilat-d₅ is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-108321S

Zofenopril-d5
Zofenopril-d₅ is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.

HY-B0231BS

Enalaprilat-d5 sodium
Enalaprilat-d₅ (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-B0279S

Ramipril-d5
Ramipril-d₅ is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-A0116S

Trandolaprilate-d5
Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor .

HY-107337S

Delapril-d3 hydrochloride
Delapril-d₃ (hydrochloride) is the deuterium labeled Delapril hydrochloride. Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases .

HY-B0279S1

Ramipril-d3
Ramipril-d₃ is the deuterium labeled Ramipril . Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

HY-B0279S2

Ramipril-d4
Ramipril-d₄ is deuterated labeled Ramipril (HY-B0279). Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

HY-B1451S

Imidapril-d3 hydrochloride
Imidapril-d₃ hydrochloride (TA-6366-d₃) is the deuterium labeled Imidapril hydrochloride. Imidapril hydrochloride (TA-6366) is the hydrochloride salt of Imidapril, an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity .

HY-B0477AS1

Quinapril-d5 hydrochloride
Quinapril-d₅ hydrochloride (CI-906-d₅) is the deuterium labeled Quinapril hydrochloride. Quinapril hydrochloride (CI-906) is a prodrug that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications .

HY-117281S1

Moexipril-d3
Moexipril-d₃ is deuterated labeled Moexipril (HY-117281). Moexipril is an orally active inhibitor of **angiotensin-converting enzyme** (ACE), and becomes effective by being hydrolyzed to moexiprila hydrochloride. Moexipril exhibits antihypertensive and neuroprotective effects ^- .

HY-B0331S1

Enalapril-d3
Enalapril-d₃ (MK-421-d₃) is deuterium labeled Enalapril. Enalapril (MK-421) is an angiotensin-converting enzyme *(ACE)* inhibitor, can be used for hypertensive diseases research .

HY-A0043S2

Cilazapril-d5 trifluoroacetate
Cilazapril-d₅ (Ro 31-2848-d₅) trifluoroacetate is the deuterium labeled Cilazapril (HY-A0043). Cilazapril is an angiotensin-converting enzyme (ACE) inhibitor used for the study of hypertension and congestive heart failure.

HY-100713S

Temocapril-d5
Temocapril-d₅ is the deuterium labeled Temocapril. Temocapril is an angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases .

HY-A0116S1

Trandolaprilate-d6
Trandolaprilate-d₆ is the deuterium labeled Trandolaprilate . Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-B1433S

Perindoprilat-d3 disodium
Perindoprilat-d₃ disodium is deuterated labeled Perindoprilat (HY-B1433). Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC₅₀ value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .

HY-B0690S

Fosinopril-d5
Fosinopril-d₅ (SQ28555-d₅ (free acid)) is deuterium labeled Fosinopril. Fosinopril (SQ28555 free acid) is the ester proagent of **angiotensin-converting enzyme** (ACE) inhibitor with an IC₅₀ value of 0.18 μM. Fosinopril demonstrates a non-competitive inhibition effect on *ACE* activity with an K_i value of 1.675 μM .

HY-B0331AS

Enalapril D5 maleate
Enalapril-d₅ (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.

HY-B0592S

Trandolapril-d5
Trandolapril-d₅ is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF) .

HY-B0477AS2

Quinapril-d4

Quinapril-d₄ (CI-906-d₄) is deuterium labeled Quinapril. Quinapril is a potent, orally active, non-peptide and nonsulfhydryl inhibitor of angiotensin-converting enzyme (ACE). Quinapril specifically interrupts the conversion of angiotensin I to angiotensin II in both plasma and tissue. Quinapril is enzymatically hydrolyzed to a pharmacologically active diacid form quinaprilat. Quinapril is efficacious in hypertensive models .

HY-B0093AS

Benazepril-d5 hydrochloride

Benazepril-d₅ hydrochloride is deuterium labeled Benazepril hydrochloride. Benazepril hydrochloride is an orally active angiotensin-converting enzyme (ACE) inhibitor to reduce angiotensin-II production. Benazepril hydrochloride inhibits oxidative stress and inhibits apoptosis by the PI3K/Akt signaling pathway. In addition, Benazepril hydrochloride improves diabetic nephropathy and decreases proteinuria. Benazepril hydrochloride can be used in the study of hypertension, heart failure and diabetic nephropathy .

HY-117281S

Moexipril-d5
Moexipril-d₅ is the deuterium labeled Moexipril. Moexipril hydrochloride is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure .

HY-109592S

Imidaprilate-d5
Imidaprilate-d₅ is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.

HY-B0368S

Captopril-d3

Captopril-d₃ is deuterium labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC₅₀ of 7.9 μM .

HY-B0130S1

Perindopril-d5

Perindopril-d₅ (S-9490-d₅) is deuterium labeled Perindopril. Perindopril (S-9490) is an orally available, long-acting angiotensin-converting enzyme (ACE) inhibitor. Perindopril inhibits inflammatory cell influx and intimal thickening, preserving elastin on the inside of the aorta. Perindopril effectively inhibits experimental abdominal aortic aneurysm (AAA) formation in a rat model and reduces pulmonary vasoconstriction in rats with pulmonary hypertension .

HY-W739949

Imidaprilat-d3
Imidaprilat-d₃ (6366A-d₃) is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC₅₀ of 2.6 nM, and is used in the research of hypertensive disease .

HY-A0115S1

Ramiprilat-d5
Ramiprilat-d₅ is deuterium labeled Ramiprilat. Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a K_i value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .

HY-B0368S1

Captopril-13C5,15N

Captopril- ¹³C₅, ¹⁵N (SQ 14225- ¹³C₅, ¹⁵N) is ¹³C and ¹⁵N labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC₅₀ of 7.9 μM .

HY-A0115S2

Ramiprilat-d4 hydrochloride
Ramiprilat-d₄ hydrochloride is deuterated labeled Ramiprilat (HY-A0115). Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active **angiotensin converting enzyme (ACE)** inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .

HY-14393S

Emodin-d4

Emodin-d₄ is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

HY-W744298

Trandolapril-d3
Trandolapril-d₃ is the deuterium labeled Trandolapril (HY-B0592). Trandolapril (RU44570) is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolaprilat. Trandolapril is an orally administered angiotensin converting enzyme (ACE) inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI) .

HY-B0592S2

rac-Trandolapril-d5

rac-Trandolapril-d₅ (rac-RU44570-d₅) is deuterium labeled Trandolapril. Trandolapril (RU44570) is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolaprilat. Trandolapril is an orally administered angiotensin converting enzyme (ACE) inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI) .

HY-P1032S2

Angiotensin I-13C6,15N (human, mouse, rat) TFA
Angiotensin I-13C6,15N (human, mouse, rat) TFA is ¹³C and ¹⁵N labeled Angiotensin I (human, mouse, rat) TFA. Angiotensin I-13C6,15N (human, mouse, rat) TFA is a precursor of angiotensin II and is cleaved into angiotensin II by angiotensin converting enzyme (ACE) .

Cat. No.	Compare	Product Name	Application	Reactivity

HY-P85784

	ACE2 Antibody (YA5476) angiotensin-converting enzyme 2; ACE-related carboxypeptidase; angiotensin-converting enzyme homolog; ACEH; Metalloprotease MPROT15; [Cleaved into: Processed angiotensin-converting enzyme 2]	WB, IHC-P, ICC/IF	Human, Mouse, Rat
	ACE2 Antibody (YA5476) is a Mouse-derived and non-conjugated monoclonal antibody, targeting to ACE2.

HY-P80003

	ACE2 Antibody (YA647) ACE-2; ACE 2; angiotensin converting enzyme 2; ACE related carboxypeptidase; ACEH; angiotensin converting enzyme homolog; angiotensin converting enzyme like protein; angiotensin I converting enzyme (peptidyl dipeptidase A) 2; angiotensin I converting enzyme 2; DKFZP434A014; EC 3.4.17; angiotensin-converting enzyme 2 precursor; ACE2_HUMAN; angiotensin-converting enzyme 2; ACE-related carboxypeptidase; angiotensin-converting enzyme homolog; Metalloprotease MPROT15; Processed angiotensin-converting enzyme 2.	WB, IHC-P, ICC/IF, IP, mIHC	Human, Mouse, Hamster
	ACE2 Antibody (YA647) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to ACE2.

HY-P86468

	ACE2 Antibody (YA6160) angiotensin-converting enzyme 2; ACE-related carboxypeptidase; angiotensin-converting enzyme homolog; ACEH; Metalloprotease MPROT15; [Cleaved into: Processed angiotensin-converting enzyme 2]	WB, IHC-P, ICC/IF, IP, ELISA	Human
	ACE2 Antibody (YA6160) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to ACE2.

HY-P85413

	ACE Antibody (YA5105) ACE; DCP; DCP1; angiotensin-converting enzyme; ACE; Dipeptidyl carboxypeptidase I; Kininase II; CD antigen CD143	WB	Human, Mouse, Rat, Bovine
	ACE Antibody (YA5105) is a Mouse-derived and non-conjugated monoclonal antibody, targeting to ACE.

HY-P81084

	ACE Antibody (YA3478) angiotensin converting enzyme 1; ACE; ACE-T; angiotensin-converting enzyme isoform 1precursor; Dipeptidyl carboxy peptidase 1; Kininase II; ACE-1; testis-specific isoform precursor. ACE 1; ACE T; ACE1; angiotensin converting enzyme somatic isoform; angiotensin converting enzyme testis specific isoform; angiotensin I converting enzyme; angiotensin I converting enzyme 1; angiotensin I converting enzyme peptidyl dipeptidase A 1; Carboxycathepsin; CD 143; CD143; CD143 antigen; DCP 1; DCP; DCP1; Dipeptidyl carboxypeptidase 1; MVCD3; Peptidase P; Peptidyl dipeptidase A; Testicular ECA; ACE_HUMAN.	WB, IHC-P, FC	Human, Mouse
	ACE Antibody (YA3478) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to ACE.

HY-P85520

	ACE Antibody (YA5212) ACE 1; ACE; ACE T; ACE_HUMAN; ACE1; angiotensin converting enzyme somatic isoform; angiotensin converting enzyme testis specific isoform; angiotensin I converting enzyme; angiotensin I converting enzyme 1; angiotensin I converting enzyme peptidyl dipeptidase A 1; angiotensin-converting enzyme; Carboxycathepsin; CD 143; CD143; CD143 antigen; DCP 1; DCP; DCP1; Dipeptidyl carboxypeptidase 1; Dipeptidyl carboxypeptidase I; Kininase II; MGC26566; MVCD3; Peptidase P; Peptidyl dipeptidase A; soluble form; Testicular ECA.	WB	Mouse
	ACE Antibody (YA5212) is a Mouse-derived and non-conjugated monoclonal antibody, targeting to ACE.

HY-P82349

	ACE Antibody (YA2094) ACE; Dipeptidyl carboxypeptidase I; Kininase II; angiotensin converting enzyme 1 Antibody	WB, IHC-P	Mouse, Rat
	ACE Antibody (YA2094) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to ACE.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Host
Reactivity
Application
Dilution Ratio
Molecular Weight
Conjugation
Clonality
Immunogen
Appearance
Isotype
Gene ID
SwissProt ID
Purity
Formulation
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社重松貿易株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

angiotensin-converting enzyme (ACE)

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Peptides

Inhibitory Antibodies

NaturalProducts

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Natural
Products