1. Search Result
Search Result
Results for "

MIP

" in MedChemExpress (MCE) Product Catalog:

32

Inhibitors & Agonists

4

Peptides

2

Natural
Products

58

Recombinant Proteins

10

Antibodies

8

Oligonucleotides

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-123733A

    RPS-001 TFA

    PSMA Cancer
    MIP-1095 (RPS-001) TFA is a potent inhibitor of PSMA with good biodistribution and efficient targeting of tumor lesions. In applications, MIP-1095 TFA will be isotopically labeled ( 131I labeled) as an imaging probe to indicate tumor progression. And 131I-MIP-1095 showed higher renal uptake in mice .
    MIP-1095 TFA
  • HY-156371

    PI3K Cardiovascular Disease Metabolic Disease
    MIPS-21335 is a PI3KC2α inhibitor with an IC50 of 7 nM. MIPS-21335 also inhibits PI3KC2β, p110α, p110β and p110δ, with IC50 values of 43, 140, 386 and 742 nM, respectively. MIPS-21335 has antithrombotic effect. MIPS-21335 can be used for the researches of cardiovascular disease and metabolic disease, such as thrombosis and hyperlipidemia .
    MIPS-21335
  • HY-129615

    PSMA Cancer
    MIP-1072 is a small molecule specific prostate-specific membrane antigen (PSMA) inhibitor. MIP-1072 inhibits the glutamate carboxypeptidase activity of PSMA with an Ki value of 4.6 nM. MIP-1072 is promising for research of prostate cancer .
    MIP-1072
  • HY-168149

    Others Cancer
    Mip-IN-2 (compound 5b) is a macrophage infection-promoting protein (MIP) protein.
    Mip-IN-2
  • HY-149861

    Bacterial Infection
    Mip-IN-1(S,S-28i)is a new rapamycin-derived macrophage infectivity potentiator (Mip) inhibitor. Mip-IN-1 displays strong anti-enzymatic activity against the Mip proteins of Neisseria meningitidis and Neisseria gonorrhoeae and substantially improved the ability of macrophages to kill the bacteria .
    Mip-IN-1
  • HY-123733

    RPS-001

    PSMA Others Cancer
    MIP-1095 potently inhibits the glutamate carboxypeptidase activity of PSMA (Ki =0.24 nM) .
    MIP-1095
  • HY-RS25791

    Small Interfering RNA (siRNA) Others

    Mip Rat Pre-designed siRNA Set A contains three designed siRNAs for Mip gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Mip Rat Pre-designed siRNA Set A
    Mip Rat Pre-designed siRNA Set A
  • HY-RS19300

    Small Interfering RNA (siRNA) Others

    Mip Mouse Pre-designed siRNA Set A contains three designed siRNAs for Mip gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Mip Mouse Pre-designed siRNA Set A
    Mip Mouse Pre-designed siRNA Set A
  • HY-RS08460

    Small Interfering RNA (siRNA) Others

    MIP Human Pre-designed siRNA Set A contains three designed siRNAs for MIP gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    MIP Human Pre-designed siRNA Set A
    MIP Human Pre-designed siRNA Set A
  • HY-120265

    PI3K Cardiovascular Disease
    MIPS-9922 is a potent and selective PI3Kβ inhibitor with an IC50 of 63 nM. MIPS-9922 inhibits PI3Kβ with >30-fold higher potency than PI3Kδ. MIPS-9922 blocks PI3K mediated activation of platelet glycoprotein αIIbβ3 activation and platelet adhesion in vitro. MIPS-9922 shows anti-platelet and anti-thrombotic activities .
    MIPS-9922
  • HY-139644

    Adenosine Receptor Neurological Disease
    MIPS521 is a positive allosteric modulator of adenosine A1 receptor (A1AR). MIPS521 also has a lower A1R allosteric affinity (pKB=4.95; KB=11 μM). MIPS521 exhibits pain-relieving effects in vivo through modulation of the increased levels of endogenous adenosine .
    MIPS521
  • HY-123661

    Endogenous Metabolite Neurological Disease
    MIPS1455 is a light-activated M1 muscarinic acetylcholine receptor ligand with irreversible binding activity to the allosteric site of the receptor. MIPS1455 is a drug target under investigation for the suppression of cognitive deficits and may become a valuable molecular tool for further investigation of allosteric interactions of the receptor .
    MIPS1455
  • HY-RS22639

    Small Interfering RNA (siRNA) Others

    Mipep Mouse Pre-designed siRNA Set A contains three designed siRNAs for Mipep gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Mipep Mouse Pre-designed siRNA Set A
    Mipep Mouse Pre-designed siRNA Set A
  • HY-RS08461

    Small Interfering RNA (siRNA) Others

    MIPEP Human Pre-designed siRNA Set A contains three designed siRNAs for MIPEP gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    MIPEP Human Pre-designed siRNA Set A
    MIPEP Human Pre-designed siRNA Set A
  • HY-B0498
    Bindarit
    20+ Cited Publications

    AF2838

    CCR Neurological Disease Inflammation/Immunology Endocrinology Cancer
    Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1β/CCL4, MIP-3/CCL23. Bindarit also has anti-inflammatory activity .
    Bindarit
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-P4191A

    CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-149650

    Toll-like Receptor (TLR) Inflammation/Immunology
    TLR4 agonist-1 (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells .
    TLR4 agonist-1
  • HY-149650A

    Toll-like Receptor (TLR) Inflammation/Immunology
    TLR4 agonist-1 (TEA) (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells .
    TLR4 agonist-1 TEA
  • HY-P3627

    Drug Derivative Cancer
    Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis .
    Nagrestipen
  • HY-103360B

    CCR Inflammation/Immunology
    trans-J-113863 is a potent chemokine CCR1 and CCR3 receptor antagonist, and inhibits MIP-1α-induced chemotaxis in CCR1 transfectants and eotaxin-induced chemotaxis in CCR3 transfectants with IC50 of 9.57 and 93.8 nM,respectively .
    trans-J-113863
  • HY-B0155

    SCH 417690; SCH-D; MK-7690 free base

    CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc
  • HY-161901

    E1/E2/E3 Enzyme Inflammation/Immunology
    BC-1293 is an inhibitor for E3 ligase subunit FBXO24. BC-1293 disrupts the interaction between FBXO24 and aspartyl-tRNA synthetase (DARS2) and increases the level of DARS2. BC-1293 increases levels of IL-1β, IL-9, MIP-2, and TNF α, and exhibits immunostimulatory activity in mice .
    BC-1293
  • HY-B0155B

    SCH 417690 malate; SCH-D malate; MK-7690

    CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) malate is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc malate can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc malate
  • HY-B2176R

    Adenosine 5'-triphosphate (Standard)

    Reference Standards Endogenous Metabolite Metabolic Disease Inflammation/Immunology
    ATP (Standard) is the analytical standard of ATP. This product is intended for research and analytical applications. ATP (Adenosine 5'-triphosphate) is a central component of energy storage and metabolism in vivo. ATP provides the metabolic energy to drive metabolic pumps and serves as a coenzyme in cells. ATP is an important endogenous signaling molecule in immunity and inflammation . In Vitro: ATP (5 mM; 1 hour) co-treatment with LPS (1 μg/mL) has a synergistic effect on the activation of the NLRP3 inflammasome in HGFs .
    ATP (2 mM; 0.5-24 hours) induces secretion of IL-1β, KC and MIP-2 from BMDMs in a caspase-1 activation-dependent manner .
    ATP promotes neutrophil chemotaxis in vitro .
    In Vivo: ATP (50 mg/kg; i.p.) protects mice against bacterial infection in vivo .
    ATP induces the secretion of IL-1β, KC and MIP-2 and neutrophils recruitment in vivo .
    ATP (Standard)
  • HY-W014081

    Ethyl 2-oxo-2H-chromene-3-carboxylate

    Drug Derivative Others
    Ethyl 3-coumarincarboxylate is a coumarin derivative. Ethyl 3-coumarincarboxylate can be used as a pseudo-template to give a molecularly imprinted polymer (MIP) that has a fairly specific recognition capability for aflatoxins .
    Ethyl 3-coumarincarboxylate
  • HY-174744

    mRNA Inflammation/Immunology
    Human CCR4 mRNA encodes the human C-C motif chemokine receptor 4 (CCR4) protein, a member of G protein-coupled receptors family. CCR4 is a receptor for the CC chemokine - MIP-1, RANTES, TARC and MCP-1. Chemokines are a group of small polypeptide, structurally related molecules that regulate cell trafficking of various types of leukocytes. The chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis.
    Human CCR4 mRNA
  • HY-P11093

    Antibiotic Bacterial Fungal Apoptosis Reactive Oxygen Species (ROS) TNF Receptor NO Synthase Interleukin Related NF-κB Toll-like Receptor (TLR) Infection Inflammation/Immunology
    Papiliocin is a potent peptide antibiotic with both anti-inflammatory and antibacterial activities. Papiliocin is primarily active against Gram-negative bacteria. Papiliocin exhibits strong anti-inflammatory activity against cell, exerting its anti-inflammatory activity by inhibiting the production of NO and the secretion of TNF-α and MIP-2. Papiliocin participates in the innate defense response mechanism by inhibiting the Toll-like receptor pathway and NF-κB. Papiliocin induces apoptosis in fungal cells and increases the total level of intracellular ROS. Papiliocin acts as an effective antiseptic peptide in sepsis models. Papiliocin is useful in anti-inflammatory and antibacterial research .
    Papiliocin
  • HY-15544

    CCR Inflammation/Immunology
    CCR1 antagonist 10 (example 1) is a potent and orally active CCR1 antagonist. CCR1 antagonist 10 inhibits 125I-MIP-1α binding to THP-1 cell membranes with an Ki value of 2.3 nM .
    CCR1 antagonist 10
  • HY-RS14859

    Small Interfering RNA (siRNA) Others

    TNPO1 Human Pre-designed siRNA Set A contains three designed siRNAs for TNPO1 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    TNPO1 Human Pre-designed siRNA Set A
    TNPO1 Human Pre-designed siRNA Set A
  • HY-19974
    TAK-220
    2 Publications Verification

    CCR HIV Infection Endocrinology
    TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC50s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC50s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC90s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.
    TAK-220
  • HY-RS20118

    Small Interfering RNA (siRNA) Others

    Tnpo1 Mouse Pre-designed siRNA Set A contains three designed siRNAs for Tnpo1 gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Tnpo1 Mouse Pre-designed siRNA Set A
    Tnpo1 Mouse Pre-designed siRNA Set A

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: