1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. Eotaxin-3/CCL26
  6. Eotaxin-3/CCL26 Protein, Human

Eotaxin-3/CCL26 Protein, Human is a CC chemokine that binds to chemokine receptors CCR3 or CX3CR1 and is a chemotactic agent for eosinophils and basophils that mediates inflammatory responses. Eotaxin-3/CCL26 Protein, Human is a recombinant human Eotaxin-3/CCL26 (T24-L94) protein expressed by E. coli
.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Eotaxin-3/CCL26 Protein, Human is a CC chemokine that binds to chemokine receptors CCR3 or CX3CR1 and is a chemotactic agent for eosinophils and basophils that mediates inflammatory responses. Eotaxin-3/CCL26 Protein, Human is a recombinant human Eotaxin-3/CCL26 (T24-L94) protein expressed by E. coli
[1].

Background

CCL26, also known as Eotaxin-3, macrophage inflammatory protein 4-alpha (MIP-4-alpha), a small cytokine of the CC chemokine family, is located on chromosome 7 in the human genome. It is expressed in a variety of tissues, including heart, lung and ovary, and in endothelial cells stimulated by the cytokine interleukin 4. It is chemotactic for eosinophils and basophils and acts by binding to the cell surface chemokine receptor CCR3 or CX3CR1. Among them, CCR3 is a CCR selectively expressed on eosinophils, basophils and some Th2 cells.CCR3 is thought to be associated with Th2-mediated diseases, including AD and asthma, while CX3CR1 is associated with Th1-mediated diseases, such as rheumatoid arthritis, diabetes mellitus, lichen planus and psoriasis. CCL26 may play a dual role in the pathogenesis of allergy and other diseases such as eosinophilic esophagitis and Churg-Strauss syndrome by attracting both CCR3-expressing cells and CX3CR1-expressing cells. In addition, CCL26 also acts as a natural antagonist of CCR1, CCR2 and CCR5[1][2].

In Vitro

CCL26 (100 nM, 18 h) induces eosinophil migration, where eosinophil migration is induced within 6 hours, then migration stabilizes until 12 hours and increases further to 18 hours with no increase after 18 hours. And CCR3 blockade completely inhibits eosinophil migration[2].

In Vivo

CCL26 (human, 5 μg in 400 μL PBS, i.p.) induces calcium mobilization not only through CCR3 but also through CX3CR1 in a PTX-sensitive manner, and induces chemotactic. Besides, it can rapidly recruit mouse eosinophils and intravenously transferred human CD16+ NK cells into the peritoneal cavity in BALB/c mice[3].

Biological Activity

Full biological activity determined by a chemotaxis bioassay using human CCR3 transfected HEK293 cells is in a concentration range of 0.5-2.0 μg/ml.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9Y258 (T24-L94)

Gene ID
Molecular Construction
N-term
CCL26 (T24-L94)
Accession # Q9Y258
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuEotaxin-3/CCL26; C-C motif chemokine 26; MIP-4-alpha; TSC-1; SCYA26
AA Sequence

TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

Predicted Molecular Mass
8.5 kDa
Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Eotaxin-3/CCL26 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Eotaxin-3/CCL26 Protein, Human
Cat. No.:
HY-P7163
Quantity:
MCE Japan Authorized Agent: