1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. GRO-gamma
  6. Animal-Free GRO-gamma/CXCL3 Protein, Human (His)

Animal-Free GRO-gamma/CXCL3 Protein, Human (His)

Cat. No.: HY-P72678AF
Handling Instructions Technical Support

The GRO-gama/CXCL3 Protein, acting as a CXCR2 ligand, induces chemotactic activity for neutrophils. It potentially influences inflammation through autocrine effects on endothelial cells. In vitro studies highlight the processed form GRO-gamma(5-73)'s fivefold increase in chemotactic activity for neutrophilic granulocytes, indicating a potential regulatory mechanism for neutrophil recruitment and function. Animal-Free GRO-gama/CXCL3 Protein, Human (His) is the recombinant human-derived animal-FreeGRO-gama/CXCL3 protein, expressed by E. coli , with N-His, N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GRO-gama/CXCL3 Protein, acting as a CXCR2 ligand, induces chemotactic activity for neutrophils. It potentially influences inflammation through autocrine effects on endothelial cells. In vitro studies highlight the processed form GRO-gamma(5-73)'s fivefold increase in chemotactic activity for neutrophilic granulocytes, indicating a potential regulatory mechanism for neutrophil recruitment and function. Animal-Free GRO-gama/CXCL3 Protein, Human (His) is the recombinant human-derived animal-FreeGRO-gama/CXCL3 protein, expressed by E. coli , with N-His, N-His labeled tag. This product is for cell culture use only.

Background

The GRO-gama/CXCL3 protein acts as a ligand for CXCR2, demonstrating chemotactic activity for neutrophils. This protein may play a role in inflammation, exerting its effects on endothelial cells in an autocrine fashion. Notably, in vitro studies reveal that the processed form GRO-gamma(5-73) exhibits a fivefold higher chemotactic activity for neutrophilic granulocytes, suggesting a potential regulatory mechanism for neutrophil recruitment and function.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <2 ng/mL.

Species

Human

Source

E. coli

Tag

N-His

Accession

P19876 (A35-N107)

Gene ID
Molecular Construction
N-term
His
CXCL3 (A35-N107)
Accession # P19876
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C-X-C motif chemokine 3; GRO-gamma; MIP2-beta; CXCL3; GRO3; GROG; SCYB3
AA Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Molecular Weight

Approximately 8.67 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free GRO-gamma/CXCL3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free GRO-gamma/CXCL3 Protein, Human (His)
Cat. No.:
HY-P72678AF
Quantity:
MCE Japan Authorized Agent: