1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-3 alpha/CCL20
  6. MIP-3 alpha/CCL20 Protein, Bovine (P. pastoris, His)

MIP-3 alpha/CCL20 Protein, Bovine (P. pastoris, His)

Cat. No.: HY-P700551
Handling Instructions Technical Support

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (P. pastoris, His) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (P. pastoris, His) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

MIP-3 alpha/CCL20 Protein serves as a ligand for C-C chemokine receptor CCR6, initiating a potent chemotactic response and mobilizing intracellular calcium ions upon CCR6 binding and activation. The CCL20-CCR6 ligand-receptor pair plays a crucial role in chemotaxis, attracting dendritic cells (DC), effector/memory T-cells, and B-cells. This partnership is particularly significant in skin and mucosal surfaces under various conditions, including homeostasis, inflammation, cancer, and autoimmune diseases. Acting as a chemotactic factor, CCL20 specifically attracts lymphocytes and, to a lesser extent, neutrophils, excluding monocytes. Furthermore, it is involved in recruiting both pro-inflammatory IL17-producing helper T-cells (Th17) and regulatory T-cells (Treg) to inflammation sites. CCL20 is essential for the optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. Additionally, it positively regulates sperm motility and chemotaxis by binding to CCR6, triggering Ca2+ mobilization in sperm, a crucial factor for motility. CCL20 may also contribute to the formation and function of mucosal lymphoid tissues by directing lymphocytes and dendritic cells towards epithelial cells.

Species

Bovine

Source

P. pastoris

Tag

N-6*His

Accession

Q8SQB1 (A27-M96)

Gene ID
Molecular Construction
N-term
6*His
CCL20 (A27-M96)
Accession # Q8SQB1
C-term
Synonyms
rHuMIP-3α/CCL20; C-C motif chemokine 20; MIP3A; SCYA20
AA Sequence

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Molecular Weight

10.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MIP-3 alpha/CCL20 Protein, Bovine (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-3 alpha/CCL20 Protein, Bovine (P. pastoris, His)
Cat. No.:
HY-P700551
Quantity:
MCE Japan Authorized Agent: