1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-1 alpha/CCL3
  6. MIP-1 alpha/CCL3 Protein, Human

MIP-1 alpha/CCL3 Protein, Human, an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Human is a recombinant human CCL3 (S24-A92) expressed by E.coil.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MIP-1 alpha/CCL3 Protein, Human, an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Human is a recombinant human CCL3 (S24-A92) expressed by E.coil[1].

Background

CCL3 also known as macrophage inflammatory protein 1-a, is a member of the CC subfamily. It’s known that CCL3 is produced by monocytes/macrophages, lymphocytes, neutrophils as well as immune cells such as basophils, mast cells, fibroblasts, and dendritic cells. Meanwhile, CCL3 exerts various biological effects by binding to its three cell surface receptors, including CCR1, CCR3, and CCR5. MIP-1a induces a variety of pro-inflammatory activities such as leukocyte chemotaxis, and promotes the entry of T cells into the inflammatory tissue region from blood circulation. Chemotactic CD4+ cells, CD8+ cells, natural killer cells, and dendritic cells bind to the corresponding receptors and coordinate the occurrence of immune reactions in the immune response site by migrating through vascular endothelial cells. In addition, MIP-1a is considered as a key inflammatory mediator in granuloma, asthma, T1D as well as other autoimmune diseases[1].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P10147 (S24-A92)

Gene ID
Molecular Construction
N-term
CCL3 (S24-A92)
Accession # P10147
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuMIP-1α/CCL3; C-C motif chemokine 3; MIP1A; SCYA3
AA Sequence

SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Molecular Weight

Approximately 12 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MIP-1 alpha/CCL3 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-1 alpha/CCL3 Protein, Human
Cat. No.:
HY-P7256
Quantity:
MCE Japan Authorized Agent: