LAG-1/CCL4L1 Protein, Human

LAG-1/CCL4L1 protein acts as a chemokine and can induce chemotaxis in cells expressing CCR5 or CCR1, indicating its role in cell migration (chemotaxis). Furthermore, it demonstrated the ability to inhibit HIV replication, particularly in CCR5-expressing peripheral blood mononuclear cells, suggesting a potential impact on antiviral defense mechanisms. LAG-1/CCL4L1 Protein, Human is the recombinant human-derived LAG-1/CCL4L1 protein, expressed by E. coli , with tag free.

LAG-1 (CCL4L1) is a chemokine with the capacity to induce chemotaxis in cells expressing CCR5 or CCR1. Notably, LAG-1 exerts an inhibitory effect on HIV replication in peripheral blood monocytes that express CCR5, highlighting its potential role in immune defense mechanisms against viral infections. This protein achieves its chemotactic effects by interacting with CCR5, underscoring its specificity in modulating cellular responses. The ability of LAG-1 to influence chemotaxis and inhibit HIV replication suggests its significance in orchestrating immune responses and potential therapeutic implications in combating viral infections (

Human

E. coli

Tag Free

Q8NHW4-1 (A24-N92)

388372

Full Length of Mature Protein

APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.