Search Result
Results for "
tri(GalNAc-PEG2)-PEG4-cyclo(Ac-DCAW-{Arg(3F-Ph)-PEG2}-LGELVWCT) (Cys2-Cys12)
" in MedChemExpress (MCE) Product Catalog:
1
Isotope-Labeled Compounds
| Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-P10388
-
|
|
CD47
TGF-β Receptor
|
Cancer
|
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
-
-
- HY-P3226
-
|
|
IGF-1R
|
Metabolic Disease
|
|
JB-1, an IGF-1 peptide analog, is a selective and potent IGF-1R antagonist. JB-1 competes with IGF-1 by binding the IGF-1 receptor. JB-1 prevents the autophosphorylation of IGF-1R, and has no activity in IGF-II .
|
-
-
- HY-P1036
-
|
|
Complement System
|
Others
|
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
-
- HY-P1036A
-
|
|
Complement System
|
Others
|
|
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
-
- HY-17584A
-
|
|
Guanylate Cyclase
|
Cancer
|
|
Linaclotide acetate is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation.
|
-
-
- HY-P5533
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
CRT, an iron peptide mimic, can bind to apo-transferrin (apo-Tf). CRT can be used to modify nanoparticles, and enhances drug delivery efficiency .
|
-
-
- HY-171910
-
|
|
Asialoglycoprotein Receptor (ASGPR)
LYTACs
|
Others
|
|
tri(GalNAc-PEG2)-PEG4-cyclo(Ac-DCAW-{Arg(3F-Ph)-PEG2}-LGELVWCT) (Cys2-Cys12) is an asialoglycoprotein receptor (ASGPR) ligand that can be used for LYsosome TArgeting Chimera (LYTAC) research .
|
-
-
- HY-P1372
-
|
|
PKC
|
Others
|
|
PKC ζ pseudosubstrate, a PKC ζ inhibitor peptide, can be attached to cell permeabilization vector peptide .
|
-
-
- HY-P10693
-
-
-
- HY-P2569
-
|
|
Apoptosis
|
Cancer
|
|
Malformin A1, a cyclic pentapeptide isolated from Aspergillus niger, possess a range of bioactive properties including antibacterial activity. Malformin A1 shows potent cytotoxic activities on human colorectal cancer cells. Malformin A1 induces apoptosis by activating PARP, caspase 3, -7, and -9 .
|
-
-
- HY-P4058
-
|
CGRP free acid
|
CGRP Receptor
|
Neurological Disease
|
|
Calcitonin gene-related peptide (CGRP) free acid is the deamidated form of α-CGRP(human) (HY-P1071). Calcitonin gene-related peptide can be used to study the effect of C-terminal amidation on CGRP .
|
-
-
- HY-P2005
-
|
|
Reactive Oxygen Species (ROS)
SOD
|
Others
|
|
Malformin C is an algicidal peptide can be isolated from Aspergillus and exhibits dose-dependent algicidal activity. Malformin C induces a significant increase in ROS levels in algal cells, resulting in impaired SOD activity and high production of MDA content .
|
-
-
- HY-P3561A
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
-
- HY-P3561
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
-
- HY-P1212
-
|
CST-14 (mouse, rat)
|
Somatostatin Receptor
|
Neurological Disease
|
|
Cortistatin 14, mouse, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus .
|
-
-
- HY-P10833
-
|
|
VEGFR
PI3K
Akt
mTOR
ERK
Apoptosis
|
Cardiovascular Disease
Cancer
|
|
C-VGB3 is a selective vascular endothelial growth factor receptor 2 (VEGFR2) antagonist, which inhibits VEGFR2-mediated PI3K/AKT/mTOR and PLCγ/ERK1/2 signaling pathways. C-VGB3 binds to the extracellular domain of VEGFR2, blocking ligand-receptor interaction and inducing apoptosis in endothelial and tumor cells through both intrinsic (involving Bcl2 family and caspases) and extrinsic (death receptor-mediated) pathways. C-VGB3 is promising for research of angiogenesis-related cancers, such as breast cancer .
|
-
-
- HY-P10793
-
|
|
EGFR
Apoptosis
|
Cancer
|
|
Cyclic(YCDGFYACYMDV) is a HER2 signaling pathway inhibitor with anti-cancer activity. This compound self-assembles into nanoparticles in aqueous solution and transforms into nanofibers upon specific binding to HER2 on cancer cells. This transformation disrupts HER2 dimerization and subsequent downstream signaling events, leading to cancer cell apoptosis (Apoptosis). The inhibitory effects on HER2 positive breast cancer have been demonstrated to be effective in a murine xenograft model .
|
-
-
- HY-P1789A
-
|
|
MMP
|
Inflammation/Immunology
Cancer
|
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
-
- HY-P10835
-
|
|
LAG-3
|
Cancer
|
|
LAG-3 cyclic peptide inhibitor C25 is a LAG-3 inhibitor. LAG-3 cyclic peptide inhibitor C25 has a high affinity with human LAG-3 protein with a Kd value of 0.66 μM. LAG-3 cyclic peptide inhibitor C25 can block the interaction of LAG-3 with HLA-DR (MHC-II) and activate CD8 + T cells. LAG-3 cyclic peptide inhibitor C25 can be used in the study of cancer .
|
-
-
- HY-P10557
-
|
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
DAG peptide is a cyclic peptide. DAG peptide selectively recognizes a subset of astrocytes that are activated in Alzheimer's disease (AD) starting at an early stage of the disease. DAG peptide can be used as a tool to enhance the delivery of therapeutics and imaging agents to sites of vascular changes and astrogliosis in diseases associated with neuroinflammation .
|
-
-
- HY-P10320
-
|
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
|
-
-
- HY-P10826
-
|
|
PD-1/PD-L1
|
Cancer
|
|
PD-1/PD-L1 inhibitory peptide C8 is inhibits PD-1/PD-L1 interaction, promotes the activation of CD8+ and CD4+ T cells, and increases the IFN-γ secretion. PD-1/PD-L1 inhibitory peptide C8 exhibits antitumor efficacy in mouse model .
|
-
-
- HY-P1565A
-
|
TD 1 Disulfide(peptide) TFA
|
Na+/K+ ATPase
|
Others
|
|
Transdermal Peptide Disulfide TFA (TD 1 Disulfide(peptide) TFA) is a 11-amino acid peptide, binds to Na +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide TFA can enhance the transdermal delivery of many macromolecules .
|
-
-
- HY-P5322
-
|
|
Transmembrane Glycoprotein
|
Cardiovascular Disease
Cancer
|
|
Thrombospondin (TSP-1)-derived CD36 binding motif is a bioactive hexapeptide. Thrombospondin (TSP-1)-derived CD36 binding motif interferes with the interaction between cells and the extracellular matrix by binding to CD36 and angiostatin, thereby affecting the cell adhesion and migration process. Thrombospondin (TSP-1)-derived CD36 binding motif inhibits platelet aggregation. Thrombospondin (TSP-1)-derived CD36 binding motif exerts an anti-tumor effect against colon cancer .
|
-
-
- HY-P2526
-
LyP-1
2 Publications Verification
|
Complement System
|
Cancer
|
|
LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
-
- HY-P4860
-
|
|
Akt
Gli
JNK
PKA
|
Metabolic Disease
|
|
Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway .
|
-
-
- HY-P4205
-
|
|
Aminopeptidase
|
Cancer
|
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
-
-
- HY-P4320
-
|
|
Integrin
|
Cancer
|
|
Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys (Disulfide bridge: Cys1-Cys10), a decapeptide containing a cyclic RGD active sequence, is an Integrin αIIbβ3 antagonist that inhibits platelet and Adhesion of proMMP-13 .
|
-
-
- HY-P4767
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (1-13) (human) is a fragment and a residues within amyloid cores of Amylin (human IAPP). Amylin is a glucose-regulating hormone, deposits as amyloid fibrils in condition of type II diabetes (T2D). Amylin (1-13) (human) has no effect on firbl formation, as it cannot form fibrils by itself .
|
-
-
- HY-P1789
-
|
|
MMP
|
Inflammation/Immunology
Cancer
|
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
-
- HY-P0090
-
|
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
-
-
- HY-P1548A
-
|
Human β-CGRP TFA; CGRP-II (Human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
-
- HY-P0049
-
|
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
-
-
- HY-A0182A
-
|
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
-
-
- HY-P0049A
-
|
Arg8-vasopressin diacetate; AVP diacetate; ADH
|
Apoptosis
Vasopressin Receptor
|
Neurological Disease
Cancer
|
|
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
|
-
-
- HY-P1574
-
|
Vasotocin, Argiprestocin, Arginine vasotocin
|
Oxytocin Receptor
|
Neurological Disease
|
|
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family .
|
-
![[Arg8]-Vasotocin](//file.medchemexpress.eu/product_pic/hy-p1574.gif)
-
- HY-P10235
-
|
|
Amylin Receptor
|
Neurological Disease
|
|
Cyclic AC253 is an antagonist for amylin receptor, with IC50 of 0.3 μM. Cyclic AC253 exhibits neuroprotective efficacy against Aβ toxicity and abrogates Aβ-induced impairment of hippocampal long-term potentiation. Cyclic AC253 penetrate blood-brain barrier (BBB) .
|
-
-
- HY-P1548
-
|
Human β-CGRP; CGRP-II (Human)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
-
- HY-P4990A
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
-
- HY-B1811
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
|
-
-
- HY-P1632A
-
|
|
Bacterial
|
Infection
Cancer
|
|
Tachyplesin I TFA is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I TFA exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
-
- HY-P4605
-
-
-
- HY-P1932
-
-
-
- HY-P5907
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain .
|
-
-
- HY-P5017
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
-
-
- HY-P1548B
-
|
Human β-CGRP acetate; CGRP-II (Human) (acetate)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
-
- HY-P10237
-
|
|
Calcium Channel
|
Others
|
|
Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and bone resorption in neonatal rat osteoclasts .
|
-
-
- HY-103303
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
CRSP-1 is short for calcitonin receptor-stimulating peptide-1. CRSP-1 inhibits osteoclast formation by inhibiting the formation and activity of multinucleated osteoclast .
|
-
-
- HY-P3953
-
-
-
- HY-P1464
-
|
Amylin (rat)
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
|
-
- HY-P1070
-
|
DAP amide, human
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
-
- HY-P1574A
-
-
![[Arg8]-Vasotocin TFA](//file.medchemexpress.eu/product_pic/hy-p1574a.gif)
- HY-P5642
-
|
RC-101
|
Bacterial
|
Infection
|
|
Retrocyclin-101 is an antimicrobial peptide against of bacterial and viral .
|
-
- HY-P1871A
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
-
- HY-P0004
-
-
- HY-P4990
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P10033
-
|
|
Ser/Thr Protease
|
Others
|
|
SFTI-1 is a cyclic peptide trypsin inhibitor consisting of 14 amino acid residues. SFTI-1 belongs to the Bowman-Birk class of inhibitors. Characterized by its small size, high stability, and potent activity, SFTI-1 can be used for research on peptide drug design platforms .
|
-
- HY-P1070A
-
|
DAP amide, human TFA
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
-
- HY-P10079
-
-
- HY-P1913A
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
-
- HY-P1913
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
-
- HY-W539944
-
|
Arg8-vasopressin acetate; AVP acetate
|
Vasopressin Receptor
Apoptosis
|
Neurological Disease
Cancer
|
|
Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
|
-
- HY-P3314
-
-
- HY-P1871
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
-
- HY-P0090A
-
|
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
-
- HY-P1463A
-
|
Thyrocalcitonin eel TFA
|
Thyroid Hormone Receptor
|
Others
|
|
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis .
|
-
- HY-A0182
-
-
- HY-P4994
-
-
- HY-P1932A
-
-
- HY-P1632
-
|
|
Bacterial
|
Infection
Cancer
|
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
- HY-P4605A
-
-
- HY-P1463
-
|
Thyrocalcitonin eel
|
Thyroid Hormone Receptor
|
Endocrinology
|
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
-
- HY-P3512
-
|
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
Cancer
|
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
-
- HY-P0256
-
-
- HY-P3563
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
[Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
|
-
![[Lys4] Sarafotoxin S6c](//file.medchemexpress.eu/product_pic/hy-p3563.gif)
- HY-P2539
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
-
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P4928
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Biotinyl-Amylin (mouse, rat) is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
-
- HY-P0207
-
|
Endothelin-2 (human, canine); Human endothelin-2
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
|
Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
-
- HY-P0204
-
-
- HY-P4928A
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Biotinyl-Amylin (mouse, rat) TFA is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
-
- HY-P3448
-
|
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
-
- HY-P4191A
-
|
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P0202A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P5809
-
-
- HY-P3433
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
-
- HY-17571F
-
|
Biotin-α-Hypophamine; Biotin-Oxytocic hormone
|
Oxytocin Receptor
|
Others
|
|
Biotin-Oxytocin (Biotin-α-Hypophamine; Biotin-Oxytocic hormone) is a biological active peptide. (This is Oxytocin (HY-17571) N-terminally labeled with Biotin.)
|
-
- HY-P5130
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic response in conscious Sprague-Dawley rats. Big endothelin-1 (rat 1-39) raises blood pressure in mice .
|
-
- HY-P10383
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
-
- HY-P5873
-
|
JZTX-X
|
Potassium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-X (JZTX-X) is a selective Kv4.2 and Kv4.3 potassium channels inhibitor. Jingzhaotoxin-X causes long-lasting mechanical hyperalgesia .
|
-
- HY-P10383A
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-1(HY-P10383). SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
-
- HY-P0256A
-
|
Apamine TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Apamin TFA (Apamine TFA) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
-
- HY-P0202
-
-
- HY-P3571
-
|
|
Endothelin Receptor
|
Cancer
|
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
-
![[Ala2] Endothelin-3, human](//file.medchemexpress.eu/product_pic/hy-p3571.gif)
- HY-P3732
-
|
|
Integrin
|
Cancer
|
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
|
-
- HY-P10328
-
|
|
DNA/RNA Synthesis
|
Metabolic Disease
|
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
-
- HY-P2538
-
-
- HY-102029
-
|
SRTX-c
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Sarafotoxin S6c (SRTX-c) is a potent endothelin-B receptor agonist. Sarafotoxin S6c can cause vasoconstriction in both endothelium-intact and endothelium-denuded vessels .
|
-
- HY-P0204A
-
-
- HY-P3565
-
|
STX-b
|
Calcium Channel
|
Cardiovascular Disease
|
|
Sarafotoxin S6d (STX-b) is a polypeptide toxin isolated from the venom of the Israeli sand boa constrictor. Sarafotoxin S6d induces multiple electrocardiogram (ECG) changes including myocardial ischemia and hyperkalemia. Sarafotoxin S6d induces strong extracellular calcium-dependent vasoconstriction in rat aorta and exhibits positive inotropic effects in rat atria. Sarafotoxin S6d can be used in the study of cardiovascular diseases .
|
-
- HY-P0207A
-
|
Endothelin-2 (49-69) (human, canine) TFA; Human endothelin-2 TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
|
Endothelin-2 (49-69), human (TFA) (Endothelin-2 (49-69) (human, canine) (TFA)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
-
- HY-P5800
-
|
μ-TrTx-Phlo1b
|
Sodium Channel
|
Neurological Disease
|
|
Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
-
- HY-P4678
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
- HY-P3204
-
POT-4
1 Publications Verification
AL-78898A
|
Complement System
|
Metabolic Disease
|
|
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
|
-
- HY-P5738
-
|
|
Bacterial
|
Infection
|
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
-
- HY-P0083
-
|
POR-8
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Ornipressin (POR-8) is a vasopressin agonist specific for the V1 receptor. Ornipressin can be used as a local vasoconstrictor. Ornipressin can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin has antidiuretic activity. Ornipressin decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
-
- HY-P1681A
-
|
|
Sodium Channel
|
Neurological Disease
|
|
GpTx-1 TFA is a peptide-based NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. GpTx-1 TFA demonstrates potent inhibitory activity against the NaV1.7 channel with an IC50 value of 10 nM, while exhibiting excellent selectivity for NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM), showing >20-fold and >950-fold selectivity respectively .
|
-
- HY-108814
-
|
DX-88
|
Kallikrein
|
Cardiovascular Disease
|
|
Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema .
|
-
- HY-P5942
-
-
- HY-P3282
-
|
|
Guanylate Cyclase
|
Metabolic Disease
|
|
MM 419447, a linaclotide metabolite, is a guanylate cyclase-C agonist. MM 419447 has the potential for the research of the irritable bowel syndrome with constipation (IBS-C) .
|
-
- HY-P1681
-
|
|
Sodium Channel
|
Neurological Disease
|
|
GpTx-1 is a peptide-based NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. GpTx-1 demonstrates potent inhibitory activity against the NaV1.7 channel with an IC50 value of 10 nM, while exhibiting excellent selectivity for NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM), showing >20-fold and >950-fold selectivity respectively .
|
-
- HY-P5871
-
|
JzTx-XII
|
Potassium Channel
|
Others
|
|
Jingzhaotoxin-XII (JzTx-XII) is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII interacts with the channels by modifying the gating behavior .
|
-
- HY-P4370
-
|
|
Bacterial
Fungal
|
Infection
|
|
Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains .
|
-
- HY-P4678A
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
- HY-P2315
-
|
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
-
- HY-P5869
-
|
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
-
- HY-P5900
-
|
m3-HwTx-IV
|
Sodium Channel
|
Neurological Disease
|
|
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model .
|
-
- HY-P0083A
-
|
POR-8 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Ornipressin (POR-8) acetate is a potent vasoconstrictor, hemostatic and renal agent. Ornipressin acetate is a vasopressin agonist specific for the V1 receptor. Ornipressin acetate can be used as a local vasoconstrictor. Ornipressin acetate can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin acetate has antidiuretic activity. Ornipressin acetate decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
-
- HY-108814A
-
|
DX-88 TFA
|
Kallikrein
|
Cardiovascular Disease
|
|
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema .
|
-
- HY-P5801
-
|
μ-TrTx-Phlo1a
|
Sodium Channel
|
Neurological Disease
|
|
Phlo1a (μ-TrTx-Phlo1a) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1a has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
-
- HY-P5871A
-
|
JzTx-XII TFA
|
Potassium Channel
|
Others
|
|
Jingzhaotoxin-XII (JzTx-XII) TFA is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII TFA interacts with the channels by modifying the gating behavior .
|
-
- HY-P5872
-
|
JZTX-XI
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin XI (JZTX-XI) is a sodium conductance inhibitor with an IC50 of 124 nM. Jingzhaotoxin XI slows the fast inactivation (EC50=1.18±0.2 μM) of Nav1.5 expressed in Chinese hamster ovary (CHO-K1) cells .
|
-
- HY-P1371
-
|
KKWKMRRNQFWIKIQRC CSVEIWD*
|
PKC
|
Others
|
|
Pseudo RACK1, a peptide, is a PKC agonist with homologous sequences of PKC. Pseudo RACK1 interacts selectively with β-PKC at an autoregulatory site (RACK-binding site) and activates it in the absence of PKC activators, following inducing PKC-mediated histone phosphorylation .
|
-
- HY-P0173B
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker . Anti-cancer activity .
|
-
- HY-P5177
-
-
- HY-P2496
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P1139
-
|
PCFWKTCK
|
GHSR
|
Metabolic Disease
|
|
Cortistatin-8 (CST-8; PCFWKTCK), a neuropeptide, is a GHS-R1a antagonist by counteracting the response of ghrelin on gastric acid secretion. Cortistatin-8 can modulate GH release from somatotroph cells. Cortistatin-8 is a synthetic CST-analogue devoid of any binding affinity to SST-R but capable to bind the GHS-R1a. Cortistatin-8 can exert antagonistic effects on ghrelin actions either in vitro or in vivo in animals .
|
-
- HY-P5179
-
|
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
-
- HY-P5160
-
|
PhlTx1
|
Sodium Channel
|
Neurological Disease
|
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
-
- HY-P5183
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Hm1a is a disulfide-rich spider-venom peptide, and a NaV1.1 activator. Hm1a restores the function of inhibitory interneurons in Dravet syndrome (DS) mouse model .
|
-
- HY-P3071
-
|
Stichodactyla helianthus neurotoxin
|
Potassium Channel
|
Inflammation/Immunology
|
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
-
- HY-P5868
-
|
|
Sodium Channel
|
Neurological Disease
|
|
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages .
|
-
- HY-P5010
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
-
- HY-P10924
-
|
|
Elastase
|
Metabolic Disease
|
|
Roseltide rT1 is a neutrophil elastase inhibitor (IC50=0.47 μM) rich in cysteine and one of the Roseltide (rT1-rT8) family members. Roseltide rT1 improves cAMP accumulation stimulated by neutrophil elastase in vitro, showing potential for inhibiting related diseases .
|
-
- HY-P5160A
-
|
PhlTx1 TFA
|
Sodium Channel
|
Neurological Disease
|
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
-
- HY-P5164
-
|
|
Sodium Channel
|
Neurological Disease
|
|
GrTx1 is a peptide toxin originally isolated from the venom of the spider Grammostola rosea. GrTx1 blocks sodium channel, with IC50s of 0.63 μM, 0.23 μM, 0.77 μM, 1.29 μM, 0.63 μM and 0.37 μM for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7, repectively . GrTx1 can be used for neurological disease research .
|
-
- HY-P0173A
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
-
- HY-P0090S
-
|
Salmon calcitonin-13C6,15N4 TFA
|
CGRP Receptor
|
Metabolic Disease
|
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
-
- HY-P5916
-
|
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
|
Others
Potassium Channel
|
Neurological Disease
|
|
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
|
-
- HY-P2786A
-
-
- HY-P10239
-
|
|
Somatostatin Receptor
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
|
Tyr3-Octreotate is a somatostatin analog. Tyr3-Octreotate exhibits high uptake into tumor, that is capable to be labeled with radioactive metal and thus exhibits antitumor efficacy. Tyr3-Octreotate can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
-
- HY-P5184
-
|
HNTX-IV
|
Sodium Channel
|
Neurological Disease
|
|
Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif .
|
-
- HY-P10837
-
|
|
LAG-3
|
Inflammation/Immunology
Cancer
|
|
LAG-3 cyclic peptide inhibitor 12 (Cyclic peptide 12) is an inhibitor of LAG-3 with an IC50 value of 4.45 μM and a Ki value of 2.66 µM .
|
-
- HY-P2785A
-
-
- HY-P5154A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P5180
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
-
- HY-P10239A
-
|
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
|
Tyr3-Octreotate acetate is a somatostatin analog. Tyr3-Octreotate acetate exhibits high uptake into tumor, that is capable to be labeled with radioactive metal and thus exhibits antitumor efficacy. Tyr3-Octreotate acetate can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
-
- HY-P5626
-
|
|
Bacterial
|
Infection
|
|
Seabream hepcidin is an antimicrobial peptide with anti-bacterial (V.anguillarum), fungal (S.cerevisiae) and viral hemorrhagic septicemia virus activity .
|
-
- HY-P5153
-
|
μ-TRTX-Tp1a
|
Sodium Channel
|
Neurological Disease
|
|
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia .
|
-
- HY-P3064
-
|
Leiurotoxin I
|
Potassium Channel
|
Neurological Disease
|
|
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo .
|
-
- HY-P11071
-
|
|
PCSK9
|
Cardiovascular Disease
|
|
PCSK9 Inhibitor, EGF-A is a PCSK9 inhibitor. PCSK9 Inhibitor, EGF-A is residues 293-334 of the EGF-A domain of the low-density lipoprotein (LDL) receptor. PCSK9 Inhibitor, EGF-A can prevent PCSK9-induced intracellular LDLR degradation. PCSK9 Inhibitor, EGF-A can be used in the study of hypercholesterolemia and premature atherosclerosis .
|
-
- HY-P3171
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Acetyl-(Cys4,D-Phe7,Cys10)-a-MSH (4-13) is a melanotropin cyclic peptide. Acetyl-(Cys4,D-Phe7,Cys10)-a-MSH (4-13) ultraprolongs melanotropic activity in frog and lizard skin model with great agonisim. Acetyl-(Cys4,D-Phe7,Cys10)-a-MSH (4-13) exhibits a complete resistance to tryptic degradation .
|
-
- HY-161096
-
|
|
ROR
|
Cancer
|
|
Antitumor agent-127 (compound 1) is a parent macrocyclic peptide. Antitumor agent-127 displays nanomolar cell-based binding to ROR1 and relatively good internalization in 786-O and MDA-MB-231 tumor cell lines .
|
-
- HY-P11032
-
|
|
SARS-CoV
Virus Protease
|
Infection
|
|
Mp-4D7-pF2, a cell-penetrating bicyclic peptide, is a noncovalent SARS-CoV-2 main protease inhibitor with an IC50 of 4.51 μM. Mp-4D7-pF2 has an antiviral activity against SARS-CoV-2 with no cytotoxicity. Mp-4D7-pF2 can used for COVID-19 infections research .
|
-
- HY-P5154
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P5155
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats .
|
-
- HY-P10860
-
|
|
Factor Xa
|
Cardiovascular Disease
|
|
cMCoFx1 is a potent and selective FXIIa cyclic peptide inhibitor. cMCoFx1 has high binding affinity (KD: 900 pM) and inhibitory activity (Ki: 370 pM) for FXIIa. cMCoFx1 can effectively inhibit endogenous clotting pathways, and cMCoFx1 is stable in serum and non-cytotoxic .
|
-
- HY-P2785
-
-
- HY-P5140
-
|
|
Calcium Channel
|
Metabolic Disease
|
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
-
- HY-P1959
-
-
- HY-P1408A
-
|
|
Integrin
|
Cancer
|
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
-
- HY-P0036B
-
|
SMS 201-995 pamoate
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
|
Octreotide (SMS 201-995) pamoate is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide pamoate can bind to the somatostatin receptors which are mainly subtypes 2, 3 and 5. Octreotide pamoate increases Gi activity and reduces intracellular cAMP production. Octreotide pamoate has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
-
- HY-P0036
-
Octreotide
Maximum Cited Publications
14 Publications Verification
SMS 201-995
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
|
Octreotide (SMS 201-995) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide (SMS 201-995) can bind to the somatostatin receptor and mainly subtypes 2, 3, and 5, increases Gi activity, and reduces intracellular cAMP production. Octreotide (SMS 201-995) has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
-
- HY-P1408
-
|
|
Integrin
|
Cancer
|
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
-
- HY-P0061
-
-
- HY-P10920
-
|
|
Drug Derivative
|
Cancer
|
|
DOTAMTATE is a somatostatin analogue. DOTAMTATE marked 212Pb is promising for research of somatostatin receptor positive neuroendocrine tumors .
|
-
- HY-P2026
-
|
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
|
|
A 71915 is a highly potent and competitive natriuretic peptide receptor A (ANP, NPRA) antagonist (pKi= 9.18). A 71915 displaces [ 125I]ANP dose dependently, with a Ki of 0.65 nM. A71915( pA2= 9.48) against rat ANP-induced cGMP production in NB-OK-1 cells .
|
-
- HY-P1980
-
|
|
Apoptosis
|
Metabolic Disease
|
|
A-71915 (TFA) is a selective inhibitor of ANP receptor (atrial natriuretic peptide-receptor), induces apoptosis and decreases insulin secretion in RINm5F pancreatic β-cells .
|
-
- HY-P0061B
-
|
RC160 diacetate; BMY 41606 diacetate
|
Neurokinin Receptor
|
Cancer
|
|
Vapreotide diacetate is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM.
|
-
- HY-P1959A
-
|
BIM 23014 acetate
|
Somatostatin Receptor
|
Endocrinology
Cancer
|
|
Lanreotide (BIM 23014) acetate is a somatostatin analogue with antineoplastic activity. Lanreotide acetate can be used for the research of carcinoid syndrome .
|
-
- HY-P0061A
-
|
RC-160 acetate; BMY-41606 acetate
|
Neurokinin Receptor
|
Cancer
|
|
Vapreotide acetate (RC-160 acetate; BMY-41606 acetate) is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM.
|
-
- HY-P1959B
-
|
BIM 23014 diTFA
|
Somatostatin Receptor
|
Endocrinology
Cancer
|
|
Lanreotide (BIM 23014) diTFA is a somatostatin analogue with antineoplastic activity. Lanreotide diTFA can be used for the research of carcinoid syndrome .
|
-
- HY-P5162
-
|
|
Sodium Channel
|
Inflammation/Immunology
|
|
Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities .
|
-
- HY-P10273A
-
|
|
Radionuclide-Drug Conjugates (RDCs)
Biochemical Assay Reagents
|
Cancer
|
|
DOTA-Octreotide TFA is composed of chelator DOTA and Octreotide (HY-P0036). DOTA-Octreotide TFA is used for research of cancer through combination with radioactive elements. DOTA-Octreotide TFA can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
-
- HY-P5917
-
|
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
|
Vm24-toxin (Vaejovis mexicanus peptide 24), a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
-
- HY-P5568
-
|
RP 71955
|
HIV
|
Infection
|
|
RP 71955 is an antimicrobial peptide against HIV-1 .
|
-
- HY-P4764
-
|
|
Melanocortin Receptor
|
Cardiovascular Disease
|
|
Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 is a cyclic octapeptide with MC4R agonism. Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 significantly increases heart rate and blood pressure .
|
-
- HY-P5917A
-
|
Vaejovis mexicanus peptide 24 TFA
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
|
Vm24-toxin (Vaejovis mexicanus peptide 24) TFA, a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin TFA shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin TFA folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin TFA attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
-
- HY-P10273
-
-
- HY-P10730
-
|
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
|
DOTA-Lanreotide is a radionuclide conjugate (RDC), which is capable of binding to a radionuclide. RDC has the ability to specifically target biomolecules and can be used in medical imaging or therapy .
|
-
- HY-P4745
-
|
|
MCHR1 (GPR24)
|
Metabolic Disease
|
|
hMCH-1R antagonist 1 (Compound 30) is an effective and selective antagonist of human melanin-concentrating hormone receptor 1 (hMCHR1) with an KB value of 3.6 nM. HMCH-1R antagonist 1 can bind to hMCHR1 and hMCHR2 with IC50 values of 65 nM and 49 nM, respectively. HMCH-1R antagonistist 1 can be used for metabolic research .
|
-
- HY-P1682A
-
|
POL6326 TFA
|
CXCR
Arrestin
|
Cancer
|
|
Balixafortide TFA (POL6326 TFA) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide TFA shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide TFA blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide TFA is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
-
- HY-P2112
-
|
DOTA-Nal3-octreotide
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Others
|
|
DOTA-NOC (DOTA-Nal3-octreotide) is a high-affinity ligand of somatostatin receptor subtypes 2, 3 and 5. DOTA-NOC can be used for labeling with various radiometals, and development of radiopeptide imaging . DOTA-NOC can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
-
- HY-P1682
-
|
POL6326
|
CXCR
Arrestin
|
Cancer
|
|
Balixafortide (POL6326) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
-
- HY-P4555
-
|
|
Somatostatin Receptor
|
Neurological Disease
|
|
(D-Phe5,Cys6,11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide (Compound 4) is a somatostatin analog with Kds of 0.61, 11.05, 23.5, 1200 and >1000 nM for SSTR5, SSTR3, SSTR2, SSTR1 and SSTR4, respectively .
|
-
- HY-P1206
-
|
|
Somatostatin Receptor
|
Neurological Disease
|
|
CH 275 is a peptide analog of somatostatin and binds preferably to somatostatin receptor 1 (sst1) with a Ki of 52 nM . CH 275 acts as a potent and selective sst1 agonist (IC50=30.9 nM) and also displays IC50 values of 345 nM, >1 μM, >10 μM, >10 μM for human sst3, sst4, sst2 and sst5, respectively . CH 275 can be used for the research of alzheimer’s disease .
|
-
- HY-106302
-
|
Moli1901; Lancovutide
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Duramycin (Moli1901) is a lantibiotic derived from Streptomyces cinnamoneuma. Duramycin also is a antimicrobial peptide. Duramycin can be used for the research of cystic fibrosis (CF) .
|
-
- HY-P3215A
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Oxytocin parallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P10698
-
|
|
Peptide-Drug Conjugates (PDCs)
LDLR
|
Neurological Disease
|
|
VH-N412 is a vectorized neuropeptide (NT) with good blood-brain barrier permeability. VH-N412 binds to the low-density lipoprotein receptor (LDLR) and neuropeptide receptor 1 (NTSR-1), and acts as a pharmacological-induced hypothermia (PIH) inducer. VH-N412 exhibits anticonvulsant and neuroprotective effects, and can be used in the study of neurological diseases such as epilepsy.
|
-
- HY-P3215
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P3124
-
|
|
Somatostatin Receptor
|
Cancer
|
|
BIM-23190, a somatostatin analog, a selective SSTR2 and SSTR5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
-
- HY-P3124A
-
|
|
Somatostatin Receptor
|
Cancer
|
|
BIM-23190 hydrochloride, a somatostatin analog, a selective SSRT2 and SSRT5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
-
- HY-P2434
-
|
|
Somatostatin Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
|
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC50: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .
|
-
- HY-P5362A
-
|
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Cancer
|
|
NODAGA-LM3 TFA can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 TFA is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas. NODAGA-LM3 TFA can be labeled with [68Ga] for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
-
- HY-P5362
-
|
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Cancer
|
|
NODAGA-LM3 can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas. NODAGA-LM3 can be labeled with [68Ga] for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
-
- HY-P10934
-
|
LXY2
|
Integrin
|
Cancer
|
|
LXY3 (LXY2) is a VLA-3-blocking peptide that inhibits the interaction between integrin α3β1 (VLA-3) on neutrophil surfaces and laminin in the basement membrane, thereby preventing neutrophil migration across the tumor vascular basement membrane barrier. LXY3 is used to block neutrophil-mediated nanoparticle release from perivascular pools into the tumor interstitium. LXY3 is commonly employed for targeted imaging of breast cancer .
|
-
- HY-P1955
-
|
Velcalcetide; AMG 416; KAI-4169
|
CaSR
|
Metabolic Disease
|
|
Etelcalcetide (AMG 416; KAI-4169) is a synthetic calcimimetic as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis, which is promising for research in the field of secondary hyperparathyroidism and chronic kidney disease .
|
-
- HY-17365
-
-
- HY-P10798A
-
|
LY-3841136 sodium
|
Amylin Receptor
|
Metabolic Disease
|
|
Eloralintide (LY 3841136) sodium is an AMYR agonist, which is promising for research of type 2 diabetes and obesity .
|
-
- HY-P10798
-
-
| Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P10388
-
|
|
CD47
TGF-β Receptor
|
Cancer
|
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
-
- HY-P3226
-
|
|
IGF-1R
|
Metabolic Disease
|
|
JB-1, an IGF-1 peptide analog, is a selective and potent IGF-1R antagonist. JB-1 competes with IGF-1 by binding the IGF-1 receptor. JB-1 prevents the autophosphorylation of IGF-1R, and has no activity in IGF-II .
|
-
- HY-P1036
-
|
|
Complement System
|
Others
|
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-P1036A
-
|
|
Complement System
|
Others
|
|
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-17584A
-
|
|
Guanylate Cyclase
|
Cancer
|
|
Linaclotide acetate is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation.
|
-
- HY-P5533
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
CRT, an iron peptide mimic, can bind to apo-transferrin (apo-Tf). CRT can be used to modify nanoparticles, and enhances drug delivery efficiency .
|
-
- HY-P1372
-
|
|
PKC
|
Others
|
|
PKC ζ pseudosubstrate, a PKC ζ inhibitor peptide, can be attached to cell permeabilization vector peptide .
|
-
- HY-P10332
-
|
|
Peptides
|
Others
|
|
WL 47 dimer (ligand 1) is a caveolin-1 (CAV-1) ligand with high affinity, selectivity and oligomer dissociation activity. WL 47 dimer simultaneously occupies two binding sites of CAV-1, inducing the dissociation of oligomers. WL 47 dimer has 7500-fold improved affinity compared to its T20 parent ligand and an 80% decrease in sequence length. WL 47 dimer can be used to permit targeted study of CAV-1 function .
|
-
- HY-P10693
-
-
- HY-P2569
-
|
|
Apoptosis
|
Cancer
|
|
Malformin A1, a cyclic pentapeptide isolated from Aspergillus niger, possess a range of bioactive properties including antibacterial activity. Malformin A1 shows potent cytotoxic activities on human colorectal cancer cells. Malformin A1 induces apoptosis by activating PARP, caspase 3, -7, and -9 .
|
-
- HY-P4916
-
|
|
Peptides
|
Others
|
|
Somatostatin-14 (3-14) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4058
-
|
CGRP free acid
|
CGRP Receptor
|
Neurological Disease
|
|
Calcitonin gene-related peptide (CGRP) free acid is the deamidated form of α-CGRP(human) (HY-P1071). Calcitonin gene-related peptide can be used to study the effect of C-terminal amidation on CGRP .
|
-
- HY-P2005
-
|
|
Reactive Oxygen Species (ROS)
SOD
|
Others
|
|
Malformin C is an algicidal peptide can be isolated from Aspergillus and exhibits dose-dependent algicidal activity. Malformin C induces a significant increase in ROS levels in algal cells, resulting in impaired SOD activity and high production of MDA content .
|
-
- HY-P3561A
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-P3561
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-P1487
-
|
|
Peptides
|
Neurological Disease
|
|
Pressinoic Acid is a synthetic hexapeptide with potent corticotrophin-releasing activity. Pressinoic Acid is also an oxytocin inhibitor; it induces maternal behavior.
|
-
- HY-P1212
-
|
CST-14 (mouse, rat)
|
Somatostatin Receptor
|
Neurological Disease
|
|
Cortistatin 14, mouse, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus .
|
-
- HY-P0123
-
|
|
Peptides
|
Others
|
|
SPACE peptide is a skin penetrating peptide (SPPs). SPACE peptide can enhance topical delivery of a macromolecule, hyaluronic acid .
|
-
- HY-P10833
-
|
|
VEGFR
PI3K
Akt
mTOR
ERK
Apoptosis
|
Cardiovascular Disease
Cancer
|
|
C-VGB3 is a selective vascular endothelial growth factor receptor 2 (VEGFR2) antagonist, which inhibits VEGFR2-mediated PI3K/AKT/mTOR and PLCγ/ERK1/2 signaling pathways. C-VGB3 binds to the extracellular domain of VEGFR2, blocking ligand-receptor interaction and inducing apoptosis in endothelial and tumor cells through both intrinsic (involving Bcl2 family and caspases) and extrinsic (death receptor-mediated) pathways. C-VGB3 is promising for research of angiogenesis-related cancers, such as breast cancer .
|
-
- HY-P10793
-
|
|
EGFR
Apoptosis
|
Cancer
|
|
Cyclic(YCDGFYACYMDV) is a HER2 signaling pathway inhibitor with anti-cancer activity. This compound self-assembles into nanoparticles in aqueous solution and transforms into nanofibers upon specific binding to HER2 on cancer cells. This transformation disrupts HER2 dimerization and subsequent downstream signaling events, leading to cancer cell apoptosis (Apoptosis). The inhibitory effects on HER2 positive breast cancer have been demonstrated to be effective in a murine xenograft model .
|
-
- HY-P1789A
-
|
|
MMP
|
Inflammation/Immunology
Cancer
|
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P10835
-
|
|
LAG-3
|
Cancer
|
|
LAG-3 cyclic peptide inhibitor C25 is a LAG-3 inhibitor. LAG-3 cyclic peptide inhibitor C25 has a high affinity with human LAG-3 protein with a Kd value of 0.66 μM. LAG-3 cyclic peptide inhibitor C25 can block the interaction of LAG-3 with HLA-DR (MHC-II) and activate CD8 + T cells. LAG-3 cyclic peptide inhibitor C25 can be used in the study of cancer .
|
-
- HY-P5217
-
|
|
Peptides
|
Others
|
|
CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
|
-
- HY-P10557
-
|
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
DAG peptide is a cyclic peptide. DAG peptide selectively recognizes a subset of astrocytes that are activated in Alzheimer's disease (AD) starting at an early stage of the disease. DAG peptide can be used as a tool to enhance the delivery of therapeutics and imaging agents to sites of vascular changes and astrogliosis in diseases associated with neuroinflammation .
|
-
- HY-P10320
-
|
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
|
-
- HY-P10826
-
|
|
PD-1/PD-L1
|
Cancer
|
|
PD-1/PD-L1 inhibitory peptide C8 is inhibits PD-1/PD-L1 interaction, promotes the activation of CD8+ and CD4+ T cells, and increases the IFN-γ secretion. PD-1/PD-L1 inhibitory peptide C8 exhibits antitumor efficacy in mouse model .
|
-
- HY-P1565A
-
|
TD 1 Disulfide(peptide) TFA
|
Na+/K+ ATPase
|
Others
|
|
Transdermal Peptide Disulfide TFA (TD 1 Disulfide(peptide) TFA) is a 11-amino acid peptide, binds to Na +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide TFA can enhance the transdermal delivery of many macromolecules .
|
-
- HY-P5322
-
|
|
Transmembrane Glycoprotein
|
Cardiovascular Disease
Cancer
|
|
Thrombospondin (TSP-1)-derived CD36 binding motif is a bioactive hexapeptide. Thrombospondin (TSP-1)-derived CD36 binding motif interferes with the interaction between cells and the extracellular matrix by binding to CD36 and angiostatin, thereby affecting the cell adhesion and migration process. Thrombospondin (TSP-1)-derived CD36 binding motif inhibits platelet aggregation. Thrombospondin (TSP-1)-derived CD36 binding motif exerts an anti-tumor effect against colon cancer .
|
-
- HY-P2526
-
LyP-1
2 Publications Verification
|
Complement System
|
Cancer
|
|
LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
- HY-P4860
-
|
|
Akt
Gli
JNK
PKA
|
Metabolic Disease
|
|
Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway .
|
-
- HY-P4205
-
|
|
Aminopeptidase
|
Cancer
|
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
-
- HY-P4320
-
|
|
Integrin
|
Cancer
|
|
Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys (Disulfide bridge: Cys1-Cys10), a decapeptide containing a cyclic RGD active sequence, is an Integrin αIIbβ3 antagonist that inhibits platelet and Adhesion of proMMP-13 .
|
-
- HY-P4767
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (1-13) (human) is a fragment and a residues within amyloid cores of Amylin (human IAPP). Amylin is a glucose-regulating hormone, deposits as amyloid fibrils in condition of type II diabetes (T2D). Amylin (1-13) (human) has no effect on firbl formation, as it cannot form fibrils by itself .
|
-
- HY-P2526A
-
|
|
Peptides
|
Cancer
|
|
LyP-1 TFA is a cyclic 9 amino acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
- HY-P1789
-
|
|
MMP
|
Inflammation/Immunology
Cancer
|
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P3222A
-
|
|
Peptides
|
Endocrinology
|
|
Oxytocin antiparallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P3222
-
|
|
Peptides
|
Endocrinology
|
|
Oxytocin antiparallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P0090
-
|
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
-
- HY-P1548A
-
|
Human β-CGRP TFA; CGRP-II (Human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P0049
-
|
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
-
- HY-P1737
-
|
Con-S
|
Peptides
|
Cardiovascular Disease
|
|
Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM .
|
-
- HY-A0182A
-
|
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
-
- HY-P0049A
-
|
Arg8-vasopressin diacetate; AVP diacetate; ADH
|
Apoptosis
Vasopressin Receptor
|
Neurological Disease
Cancer
|
|
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
|
-
- HY-P5166
-
|
|
Peptides
|
Others
|
|
Lys-Conopressin-G, a vasotocin-like peptide, can be isolated from the venom of the worm-hunting snail (conus imperialis) .
|
-
- HY-P1574
-
|
Vasotocin, Argiprestocin, Arginine vasotocin
|
Oxytocin Receptor
|
Neurological Disease
|
|
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family .
|
-
- HY-P10235
-
|
|
Amylin Receptor
|
Neurological Disease
|
|
Cyclic AC253 is an antagonist for amylin receptor, with IC50 of 0.3 μM. Cyclic AC253 exhibits neuroprotective efficacy against Aβ toxicity and abrogates Aβ-induced impairment of hippocampal long-term potentiation. Cyclic AC253 penetrate blood-brain barrier (BBB) .
|
-
- HY-P1548
-
|
Human β-CGRP; CGRP-II (Human)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P4990A
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P4912
-
|
|
Peptides
|
Others
|
|
Big Endothelin-1 (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-B1811
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
|
- HY-P1632A
-
|
|
Bacterial
|
Infection
Cancer
|
|
Tachyplesin I TFA is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I TFA exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
- HY-P4605
-
- HY-P1932
-
- HY-P5907
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain .
|
- HY-P5017
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
- HY-P1548B
-
|
Human β-CGRP acetate; CGRP-II (Human) (acetate)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P10237
-
|
|
Calcium Channel
|
Others
|
|
Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and bone resorption in neonatal rat osteoclasts .
|
- HY-103303
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
CRSP-1 is short for calcitonin receptor-stimulating peptide-1. CRSP-1 inhibits osteoclast formation by inhibiting the formation and activity of multinucleated osteoclast .
|
- HY-P3953
-
- HY-P1464
-
|
Amylin (rat)
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
|
- HY-P1070
-
|
DAP amide, human
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
- HY-P1574A
-
- HY-P5642
-
|
RC-101
|
Bacterial
|
Infection
|
|
Retrocyclin-101 is an antimicrobial peptide against of bacterial and viral .
|
- HY-P1871A
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
- HY-P0004
-
- HY-P4990
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
- HY-P10033
-
|
|
Ser/Thr Protease
|
Others
|
|
SFTI-1 is a cyclic peptide trypsin inhibitor consisting of 14 amino acid residues. SFTI-1 belongs to the Bowman-Birk class of inhibitors. Characterized by its small size, high stability, and potent activity, SFTI-1 can be used for research on peptide drug design platforms .
|
- HY-P1070A
-
|
DAP amide, human TFA
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
- HY-P10079
-
- HY-P1913A
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
- HY-P1913
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
- HY-P4184
-
|
(Ser4,Ile8)-Oxytocin
|
Peptides
|
Others
|
|
Isotocin ((Ser4,Ile8)-Oxytocin) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-W539944
-
|
Arg8-vasopressin acetate; AVP acetate
|
Vasopressin Receptor
Apoptosis
|
Neurological Disease
Cancer
|
|
Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
|
- HY-P4184A
-
|
(Ser4,Ile8)-Oxytocin acetate
|
Peptides
|
Others
|
|
Isotocin (acetate) ((Ser4,Ile8)-Oxytocin (acetate)) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3314
-
- HY-P1871
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
- HY-P0090A
-
|
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
- HY-P1463A
-
|
Thyrocalcitonin eel TFA
|
Thyroid Hormone Receptor
|
Others
|
|
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis .
|
- HY-P4973
-
|
|
Peptides
|
Others
|
|
Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-A0182
-
- HY-P4994
-
- HY-P1932A
-
- HY-P1632
-
|
|
Bacterial
|
Infection
Cancer
|
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
- HY-P4605A
-
- HY-P1463
-
|
Thyrocalcitonin eel
|
Thyroid Hormone Receptor
|
Endocrinology
|
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
- HY-P3512
-
|
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
Cancer
|
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
- HY-P0256
-
- HY-P11030
-
|
|
Peptides
|
Cancer
|
|
Ahx-CES is a CES peptide-linker conjugate targeting Synaptosomal associated protein 25 (SNAP25). Ahx-CES can be used for synthesis of peptide-drug conjugates with Verteporfin (HY-B0146) for cancers research .
|
- HY-P3563
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
[Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
|
- HY-P2539
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
- HY-P4946
-
|
|
Peptides
|
Others
|
|
Biotinyl-α-CGRP (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4928
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Biotinyl-Amylin (mouse, rat) is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
- HY-P0207
-
|
Endothelin-2 (human, canine); Human endothelin-2
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
|
Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
- HY-P0204
-
- HY-P4928A
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Biotinyl-Amylin (mouse, rat) TFA is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
- HY-P11029
-
|
|
Peptides
|
Cancer
|
|
CES (CESPLLSEC) is a homing peptide targeting Synaptosomal associated protein 25 (SNAP25). CES specifically homes in intracranial U87MG and the WT-glioblastoma (GBM) model. CES can be used as a targeting peptide for drug delivery for cancers research .
|
- HY-P3448
-
|
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
- HY-P4191A
-
|
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
- HY-P0202A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P5809
-
- HY-P3433
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
- HY-17571F
-
|
Biotin-α-Hypophamine; Biotin-Oxytocic hormone
|
Oxytocin Receptor
|
Others
|
|
Biotin-Oxytocin (Biotin-α-Hypophamine; Biotin-Oxytocic hormone) is a biological active peptide. (This is Oxytocin (HY-17571) N-terminally labeled with Biotin.)
|
- HY-P5130
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic response in conscious Sprague-Dawley rats. Big endothelin-1 (rat 1-39) raises blood pressure in mice .
|
- HY-P10383
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
- HY-P4946A
-
|
|
Peptides
|
Others
|
|
Biotinyl-α-CGRP (human) TFA is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5873
-
|
JZTX-X
|
Potassium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-X (JZTX-X) is a selective Kv4.2 and Kv4.3 potassium channels inhibitor. Jingzhaotoxin-X causes long-lasting mechanical hyperalgesia .
|
- HY-P10383A
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-1(HY-P10383). SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
- HY-P0256A
-
|
Apamine TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Apamin TFA (Apamine TFA) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
- HY-P0202
-
- HY-P3571
-
|
|
Endothelin Receptor
|
Cancer
|
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
- HY-P3732
-
|
|
Integrin
|
Cancer
|
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
|
- HY-P10328
-
|
|
DNA/RNA Synthesis
|
Metabolic Disease
|
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
- HY-P2538
-
- HY-102029
-
|
SRTX-c
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Sarafotoxin S6c (SRTX-c) is a potent endothelin-B receptor agonist. Sarafotoxin S6c can cause vasoconstriction in both endothelium-intact and endothelium-denuded vessels .
|
- HY-P4941
-
|
|
Peptides
|
Others
|
|
Biotinyl-α-CGRP (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P0204A
-
- HY-P3565
-
|
STX-b
|
Calcium Channel
|
Cardiovascular Disease
|
|
Sarafotoxin S6d (STX-b) is a polypeptide toxin isolated from the venom of the Israeli sand boa constrictor. Sarafotoxin S6d induces multiple electrocardiogram (ECG) changes including myocardial ischemia and hyperkalemia. Sarafotoxin S6d induces strong extracellular calcium-dependent vasoconstriction in rat aorta and exhibits positive inotropic effects in rat atria. Sarafotoxin S6d can be used in the study of cardiovascular diseases .
|
- HY-P0207A
-
|
Endothelin-2 (49-69) (human, canine) TFA; Human endothelin-2 TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
|
Endothelin-2 (49-69), human (TFA) (Endothelin-2 (49-69) (human, canine) (TFA)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
- HY-P5800
-
|
μ-TrTx-Phlo1b
|
Sodium Channel
|
Neurological Disease
|
|
Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
- HY-P4678
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P3204
-
POT-4
1 Publications Verification
AL-78898A
|
Complement System
|
Metabolic Disease
|
|
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
|
- HY-P5738
-
|
|
Bacterial
|
Infection
|
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
- HY-P0083
-
|
POR-8
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Ornipressin (POR-8) is a vasopressin agonist specific for the V1 receptor. Ornipressin can be used as a local vasoconstrictor. Ornipressin can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin has antidiuretic activity. Ornipressin decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
- HY-P1681A
-
|
|
Sodium Channel
|
Neurological Disease
|
|
GpTx-1 TFA is a peptide-based NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. GpTx-1 TFA demonstrates potent inhibitory activity against the NaV1.7 channel with an IC50 value of 10 nM, while exhibiting excellent selectivity for NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM), showing >20-fold and >950-fold selectivity respectively .
|
- HY-108814
-
|
DX-88
|
Kallikrein
|
Cardiovascular Disease
|
|
Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema .
|
- HY-P5942
-
- HY-P4732
-
|
|
Peptides
|
Others
|
|
5-FAM-Amylin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3282
-
|
|
Guanylate Cyclase
|
Metabolic Disease
|
|
MM 419447, a linaclotide metabolite, is a guanylate cyclase-C agonist. MM 419447 has the potential for the research of the irritable bowel syndrome with constipation (IBS-C) .
|
- HY-P1681
-
|
|
Sodium Channel
|
Neurological Disease
|
|
GpTx-1 is a peptide-based NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. GpTx-1 demonstrates potent inhibitory activity against the NaV1.7 channel with an IC50 value of 10 nM, while exhibiting excellent selectivity for NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM), showing >20-fold and >950-fold selectivity respectively .
|
- HY-P5871
-
|
JzTx-XII
|
Potassium Channel
|
Others
|
|
Jingzhaotoxin-XII (JzTx-XII) is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII interacts with the channels by modifying the gating behavior .
|
- HY-P4370
-
|
|
Bacterial
Fungal
|
Infection
|
|
Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains .
|
- HY-P4678A
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P2315
-
|
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
- HY-P5869
-
|
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
- HY-P5900
-
|
m3-HwTx-IV
|
Sodium Channel
|
Neurological Disease
|
|
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model .
|
- HY-P0083A
-
|
POR-8 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Ornipressin (POR-8) acetate is a potent vasoconstrictor, hemostatic and renal agent. Ornipressin acetate is a vasopressin agonist specific for the V1 receptor. Ornipressin acetate can be used as a local vasoconstrictor. Ornipressin acetate can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin acetate has antidiuretic activity. Ornipressin acetate decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
- HY-108814A
-
|
DX-88 TFA
|
Kallikrein
|
Cardiovascular Disease
|
|
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema .
|
- HY-P5801
-
|
μ-TrTx-Phlo1a
|
Sodium Channel
|
Neurological Disease
|
|
Phlo1a (μ-TrTx-Phlo1a) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1a has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
- HY-P5871A
-
|
JzTx-XII TFA
|
Potassium Channel
|
Others
|
|
Jingzhaotoxin-XII (JzTx-XII) TFA is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII TFA interacts with the channels by modifying the gating behavior .
|
- HY-P5872
-
|
JZTX-XI
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin XI (JZTX-XI) is a sodium conductance inhibitor with an IC50 of 124 nM. Jingzhaotoxin XI slows the fast inactivation (EC50=1.18±0.2 μM) of Nav1.5 expressed in Chinese hamster ovary (CHO-K1) cells .
|
- HY-P1371
-
|
KKWKMRRNQFWIKIQRC CSVEIWD*
|
PKC
|
Others
|
|
Pseudo RACK1, a peptide, is a PKC agonist with homologous sequences of PKC. Pseudo RACK1 interacts selectively with β-PKC at an autoregulatory site (RACK-binding site) and activates it in the absence of PKC activators, following inducing PKC-mediated histone phosphorylation .
|
- HY-P0173B
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker . Anti-cancer activity .
|
- HY-P5177
-
- HY-P2496
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P1139
-
|
PCFWKTCK
|
GHSR
|
Metabolic Disease
|
|
Cortistatin-8 (CST-8; PCFWKTCK), a neuropeptide, is a GHS-R1a antagonist by counteracting the response of ghrelin on gastric acid secretion. Cortistatin-8 can modulate GH release from somatotroph cells. Cortistatin-8 is a synthetic CST-analogue devoid of any binding affinity to SST-R but capable to bind the GHS-R1a. Cortistatin-8 can exert antagonistic effects on ghrelin actions either in vitro or in vivo in animals .
|
- HY-P5179
-
|
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
- HY-P5160
-
|
PhlTx1
|
Sodium Channel
|
Neurological Disease
|
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
- HY-P5183
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Hm1a is a disulfide-rich spider-venom peptide, and a NaV1.1 activator. Hm1a restores the function of inhibitory interneurons in Dravet syndrome (DS) mouse model .
|
- HY-P3071
-
|
Stichodactyla helianthus neurotoxin
|
Potassium Channel
|
Inflammation/Immunology
|
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
- HY-P5868
-
|
|
Sodium Channel
|
Neurological Disease
|
|
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages .
|
- HY-P5010
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
- HY-P10924
-
|
|
Elastase
|
Metabolic Disease
|
|
Roseltide rT1 is a neutrophil elastase inhibitor (IC50=0.47 μM) rich in cysteine and one of the Roseltide (rT1-rT8) family members. Roseltide rT1 improves cAMP accumulation stimulated by neutrophil elastase in vitro, showing potential for inhibiting related diseases .
|
- HY-P5160A
-
|
PhlTx1 TFA
|
Sodium Channel
|
Neurological Disease
|
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
- HY-P5164
-
|
|
Sodium Channel
|
Neurological Disease
|
|
GrTx1 is a peptide toxin originally isolated from the venom of the spider Grammostola rosea. GrTx1 blocks sodium channel, with IC50s of 0.63 μM, 0.23 μM, 0.77 μM, 1.29 μM, 0.63 μM and 0.37 μM for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7, repectively . GrTx1 can be used for neurological disease research .
|
- HY-P0173A
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
- HY-P0090S
-
|
Salmon calcitonin-13C6,15N4 TFA
|
CGRP Receptor
|
Metabolic Disease
|
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
- HY-P5916
-
|
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
|
Peptides
Potassium Channel
|
Neurological Disease
|
|
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
|
- HY-P2786A
-
- HY-P10239
-
|
|
Somatostatin Receptor
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
|
Tyr3-Octreotate is a somatostatin analog. Tyr3-Octreotate exhibits high uptake into tumor, that is capable to be labeled with radioactive metal and thus exhibits antitumor efficacy. Tyr3-Octreotate can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
- HY-P5184
-
|
HNTX-IV
|
Sodium Channel
|
Neurological Disease
|
|
Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif .
|
- HY-P10837
-
|
|
LAG-3
|
Inflammation/Immunology
Cancer
|
|
LAG-3 cyclic peptide inhibitor 12 (Cyclic peptide 12) is an inhibitor of LAG-3 with an IC50 value of 4.45 μM and a Ki value of 2.66 µM .
|
- HY-P2785A
-
- HY-P5154A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P5180
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
- HY-P10239A
-
|
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
|
Tyr3-Octreotate acetate is a somatostatin analog. Tyr3-Octreotate acetate exhibits high uptake into tumor, that is capable to be labeled with radioactive metal and thus exhibits antitumor efficacy. Tyr3-Octreotate acetate can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
- HY-P5626
-
|
|
Bacterial
|
Infection
|
|
Seabream hepcidin is an antimicrobial peptide with anti-bacterial (V.anguillarum), fungal (S.cerevisiae) and viral hemorrhagic septicemia virus activity .
|
- HY-P5153
-
|
μ-TRTX-Tp1a
|
Sodium Channel
|
Neurological Disease
|
|
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia .
|
- HY-P3064
-
|
Leiurotoxin I
|
Potassium Channel
|
Neurological Disease
|
|
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo .
|
- HY-P11071
-
|
|
PCSK9
|
Cardiovascular Disease
|
|
PCSK9 Inhibitor, EGF-A is a PCSK9 inhibitor. PCSK9 Inhibitor, EGF-A is residues 293-334 of the EGF-A domain of the low-density lipoprotein (LDL) receptor. PCSK9 Inhibitor, EGF-A can prevent PCSK9-induced intracellular LDLR degradation. PCSK9 Inhibitor, EGF-A can be used in the study of hypercholesterolemia and premature atherosclerosis .
|
- HY-P3171
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Acetyl-(Cys4,D-Phe7,Cys10)-a-MSH (4-13) is a melanotropin cyclic peptide. Acetyl-(Cys4,D-Phe7,Cys10)-a-MSH (4-13) ultraprolongs melanotropic activity in frog and lizard skin model with great agonisim. Acetyl-(Cys4,D-Phe7,Cys10)-a-MSH (4-13) exhibits a complete resistance to tryptic degradation .
|
- HY-161096
-
|
|
ROR
|
Cancer
|
|
Antitumor agent-127 (compound 1) is a parent macrocyclic peptide. Antitumor agent-127 displays nanomolar cell-based binding to ROR1 and relatively good internalization in 786-O and MDA-MB-231 tumor cell lines .
|
- HY-P11032
-
|
|
SARS-CoV
Virus Protease
|
Infection
|
|
Mp-4D7-pF2, a cell-penetrating bicyclic peptide, is a noncovalent SARS-CoV-2 main protease inhibitor with an IC50 of 4.51 μM. Mp-4D7-pF2 has an antiviral activity against SARS-CoV-2 with no cytotoxicity. Mp-4D7-pF2 can used for COVID-19 infections research .
|
- HY-P5154
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P5155
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats .
|
- HY-P10860
-
|
|
Factor Xa
|
Cardiovascular Disease
|
|
cMCoFx1 is a potent and selective FXIIa cyclic peptide inhibitor. cMCoFx1 has high binding affinity (KD: 900 pM) and inhibitory activity (Ki: 370 pM) for FXIIa. cMCoFx1 can effectively inhibit endogenous clotting pathways, and cMCoFx1 is stable in serum and non-cytotoxic .
|
- HY-P2785
-
- HY-P5140
-
|
|
Calcium Channel
|
Metabolic Disease
|
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
- HY-P5176
-
|
LtTx-1a
|
Peptides
|
Neurological Disease
|
|
Latartoxin-1a (LtTx-1a) is a peptide toxin can be isolated from L. tarabaevi. Latartoxin-1a is paralytic and lethal to insects and has membrane-bound activity .
|
- HY-P1959
-
- HY-P1408A
-
|
|
Integrin
|
Cancer
|
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
- HY-P5151
-
|
|
Peptides
|
Others
|
|
LiTx3 is a lethal and cysteine-rich peptide. LiTx3 can be isolated from L. intermedia crude venom. LiTx3 induces flaccid paralysis in Spodoptera frugiperda larvae .
|
- HY-P0036B
-
|
SMS 201-995 pamoate
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
|
Octreotide (SMS 201-995) pamoate is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide pamoate can bind to the somatostatin receptors which are mainly subtypes 2, 3 and 5. Octreotide pamoate increases Gi activity and reduces intracellular cAMP production. Octreotide pamoate has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
- HY-P0036
-
Octreotide
Maximum Cited Publications
14 Publications Verification
SMS 201-995
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
|
Octreotide (SMS 201-995) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide (SMS 201-995) can bind to the somatostatin receptor and mainly subtypes 2, 3, and 5, increases Gi activity, and reduces intracellular cAMP production. Octreotide (SMS 201-995) has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
- HY-P1408
-
|
|
Integrin
|
Cancer
|
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
- HY-P0061
-
- HY-P10920
-
|
|
Drug Derivative
|
Cancer
|
|
DOTAMTATE is a somatostatin analogue. DOTAMTATE marked 212Pb is promising for research of somatostatin receptor positive neuroendocrine tumors .
|
- HY-P2026
-
|
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
|
|
A 71915 is a highly potent and competitive natriuretic peptide receptor A (ANP, NPRA) antagonist (pKi= 9.18). A 71915 displaces [ 125I]ANP dose dependently, with a Ki of 0.65 nM. A71915( pA2= 9.48) against rat ANP-induced cGMP production in NB-OK-1 cells .
|
- HY-P1980
-
|
|
Apoptosis
|
Metabolic Disease
|
|
A-71915 (TFA) is a selective inhibitor of ANP receptor (atrial natriuretic peptide-receptor), induces apoptosis and decreases insulin secretion in RINm5F pancreatic β-cells .
|
- HY-P0061B
-
|
RC160 diacetate; BMY 41606 diacetate
|
Neurokinin Receptor
|
Cancer
|
|
Vapreotide diacetate is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM.
|
- HY-P1959A
-
|
BIM 23014 acetate
|
Somatostatin Receptor
|
Endocrinology
Cancer
|
|
Lanreotide (BIM 23014) acetate is a somatostatin analogue with antineoplastic activity. Lanreotide acetate can be used for the research of carcinoid syndrome .
|
- HY-P0061A
-
|
RC-160 acetate; BMY-41606 acetate
|
Neurokinin Receptor
|
Cancer
|
|
Vapreotide acetate (RC-160 acetate; BMY-41606 acetate) is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM.
|
- HY-P1959B
-
|
BIM 23014 diTFA
|
Somatostatin Receptor
|
Endocrinology
Cancer
|
|
Lanreotide (BIM 23014) diTFA is a somatostatin analogue with antineoplastic activity. Lanreotide diTFA can be used for the research of carcinoid syndrome .
|
- HY-P5162
-
|
|
Sodium Channel
|
Inflammation/Immunology
|
|
Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities .
|
- HY-P10273A
-
|
|
Radionuclide-Drug Conjugates (RDCs)
Biochemical Assay Reagents
|
Cancer
|
|
DOTA-Octreotide TFA is composed of chelator DOTA and Octreotide (HY-P0036). DOTA-Octreotide TFA is used for research of cancer through combination with radioactive elements. DOTA-Octreotide TFA can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
- HY-P5917
-
|
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
|
Vm24-toxin (Vaejovis mexicanus peptide 24), a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
- HY-P5568
-
|
RP 71955
|
HIV
|
Infection
|
|
RP 71955 is an antimicrobial peptide against HIV-1 .
|
- HY-P4764
-
|
|
Melanocortin Receptor
|
Cardiovascular Disease
|
|
Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 is a cyclic octapeptide with MC4R agonism. Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 significantly increases heart rate and blood pressure .
|
- HY-P5917A
-
|
Vaejovis mexicanus peptide 24 TFA
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
|
Vm24-toxin (Vaejovis mexicanus peptide 24) TFA, a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin TFA shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin TFA folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin TFA attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
- HY-P10273
-
- HY-P4745
-
|
|
MCHR1 (GPR24)
|
Metabolic Disease
|
|
hMCH-1R antagonist 1 (Compound 30) is an effective and selective antagonist of human melanin-concentrating hormone receptor 1 (hMCHR1) with an KB value of 3.6 nM. HMCH-1R antagonist 1 can bind to hMCHR1 and hMCHR2 with IC50 values of 65 nM and 49 nM, respectively. HMCH-1R antagonistist 1 can be used for metabolic research .
|
- HY-P1682A
-
|
POL6326 TFA
|
CXCR
Arrestin
|
Cancer
|
|
Balixafortide TFA (POL6326 TFA) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide TFA shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide TFA blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide TFA is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
- HY-P2112
-
|
DOTA-Nal3-octreotide
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Others
|
|
DOTA-NOC (DOTA-Nal3-octreotide) is a high-affinity ligand of somatostatin receptor subtypes 2, 3 and 5. DOTA-NOC can be used for labeling with various radiometals, and development of radiopeptide imaging . DOTA-NOC can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
- HY-P1682
-
|
POL6326
|
CXCR
Arrestin
|
Cancer
|
|
Balixafortide (POL6326) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
- HY-P4555
-
|
|
Somatostatin Receptor
|
Neurological Disease
|
|
(D-Phe5,Cys6,11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide (Compound 4) is a somatostatin analog with Kds of 0.61, 11.05, 23.5, 1200 and >1000 nM for SSTR5, SSTR3, SSTR2, SSTR1 and SSTR4, respectively .
|
- HY-P1206
-
|
|
Somatostatin Receptor
|
Neurological Disease
|
|
CH 275 is a peptide analog of somatostatin and binds preferably to somatostatin receptor 1 (sst1) with a Ki of 52 nM . CH 275 acts as a potent and selective sst1 agonist (IC50=30.9 nM) and also displays IC50 values of 345 nM, >1 μM, >10 μM, >10 μM for human sst3, sst4, sst2 and sst5, respectively . CH 275 can be used for the research of alzheimer’s disease .
|
- HY-P3215A
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Oxytocin parallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P10698
-
|
|
Peptide-Drug Conjugates (PDCs)
LDLR
|
Neurological Disease
|
|
VH-N412 is a vectorized neuropeptide (NT) with good blood-brain barrier permeability. VH-N412 binds to the low-density lipoprotein receptor (LDLR) and neuropeptide receptor 1 (NTSR-1), and acts as a pharmacological-induced hypothermia (PIH) inducer. VH-N412 exhibits anticonvulsant and neuroprotective effects, and can be used in the study of neurological diseases such as epilepsy.
|
- HY-P4980
-
|
|
Peptides
|
Others
|
|
Acetyl-Lys5-octreotide is a biologically active peptide .
|
- HY-P3215
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P3124
-
|
|
Somatostatin Receptor
|
Cancer
|
|
BIM-23190, a somatostatin analog, a selective SSTR2 and SSTR5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
- HY-P3124A
-
|
|
Somatostatin Receptor
|
Cancer
|
|
BIM-23190 hydrochloride, a somatostatin analog, a selective SSRT2 and SSRT5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
- HY-P2434
-
|
|
Somatostatin Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
|
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC50: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .
|
- HY-P5362A
-
|
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Cancer
|
|
NODAGA-LM3 TFA can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 TFA is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas. NODAGA-LM3 TFA can be labeled with [68Ga] for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
- HY-P5362
-
|
|
Radionuclide-Drug Conjugates (RDCs)
Somatostatin Receptor
|
Cancer
|
|
NODAGA-LM3 can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas. NODAGA-LM3 can be labeled with [68Ga] for the synthesis/research of Radionuclide-Drug Conjugates (RDCs) .
|
- HY-P10934
-
|
LXY2
|
Integrin
|
Cancer
|
|
LXY3 (LXY2) is a VLA-3-blocking peptide that inhibits the interaction between integrin α3β1 (VLA-3) on neutrophil surfaces and laminin in the basement membrane, thereby preventing neutrophil migration across the tumor vascular basement membrane barrier. LXY3 is used to block neutrophil-mediated nanoparticle release from perivascular pools into the tumor interstitium. LXY3 is commonly employed for targeted imaging of breast cancer .
|
- HY-P1955
-
|
Velcalcetide; AMG 416; KAI-4169
|
CaSR
|
Metabolic Disease
|
|
Etelcalcetide (AMG 416; KAI-4169) is a synthetic calcimimetic as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis, which is promising for research in the field of secondary hyperparathyroidism and chronic kidney disease .
|
- HY-17365
-
- HY-P10798A
-
|
LY-3841136 sodium
|
Amylin Receptor
|
Metabolic Disease
|
|
Eloralintide (LY 3841136) sodium is an AMYR agonist, which is promising for research of type 2 diabetes and obesity .
|
- HY-P10798
-
| Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
| Cat. No. |
Product Name |
Chemical Structure |
-
- HY-P0090S
-
|
|
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
-
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent:
![[Arg8]-Vasotocin](http://file.medchemexpress.eu/product_pic/hy-p1574.gif)
![[Arg8]-Vasotocin TFA](http://file.medchemexpress.eu/product_pic/hy-p1574a.gif)
![[Lys4] Sarafotoxin S6c](http://file.medchemexpress.eu/product_pic/hy-p3563.gif)
![[Ala2] Endothelin-3, human](http://file.medchemexpress.eu/product_pic/hy-p3571.gif)
