Search Result

Results for "

Derivative peptides

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Drug Derivative (9) Peptide-Drug Conjugates (PDCs) (2) ADC Linker (2) Amino Acid Derivatives (68) Amyloid-β (3) Angiotensin Receptor (2) Angiotensin-converting Enzyme (ACE) (1) Antibiotic (1) Apoptosis (1) Bacterial (3) Bcl-2 Family (1) Biochemical Assay Reagents (138) Bombesin Receptor (1) Calcium Channel (1) Caspase (1) Cholecystokinin Receptor (1) Cholinesterase (ChE) (3) CXCR (3) Drug Intermediate (3) Drug Metabolite (1) Drug-Linker Conjugates for ADC (7) Endogenous Metabolite (2) Fluorescent Dye (16) Fungal (1) GCGR (6) GnRH Receptor (1) GSK-3 (2) Influenza Virus (1) Interleukin Related (2) Isotope-Labeled Compounds (11) LDLR (1) Legumain (1) Microtubule/Tubulin (1) Neurokinin Receptor (1) Neuropeptide Y Receptor (2) Neurotensin Receptor (1) NOD-like Receptor (NLR) (1) Opioid Receptor (4) Parasite (1) Radionuclide-Drug Conjugates (RDCs) (21) Ras (1) Reactive Oxygen Species (ROS) (3) SARS-CoV (1) Small Interfering RNA (siRNA) (1) Somatostatin Receptor (2)
By Research Areas:	Cancer (25) Cardiovascular Disease (5) Endocrinology (3) Infection (7) Inflammation/Immunology (9) Metabolic Disease (13) Neurological Disease (14)
Click Chemistry:	DBCO (2) Azide (3) Alkynes (11)
Oligonucleotides:	Polymers (1)

287

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

130

Biochemical Assay Reagents

102

Peptides

MCE Kits

Natural
Products

Isotope-Labeled Compounds

Click Chemistry

Oligonucleotides

2,6-Dimethyl-L-tyrosine Dmt	Opioid Receptor	Neurological Disease
2,6-Dimethyl-L-tyrosine (Dmt) is a tyrosine derivative that enhances receptor affinity, functional bioactivity and in vivo analgesia of opioid peptides .

Fmoc-Tic-OH	Amino Acid Derivatives	Others
Fmoc-Tic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as the biotinylated derivative of the opioid receptor antagonist TIPP .

Fmoc-D-Dap(Boc)-OH	Radionuclide-Drug Conjugates (RDCs) Amino Acid Derivatives	Others
Fmoc-D-Dap(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as DOTA-modified peptides and their metal chelates with cancer diagnostic effects .

Boc-Leu-OH hydrate N-Boc-L-leucine monohydrate	Amino Acid Derivatives	Others
Boc-Leu-OH hydrate (N-Boc-L-leucine monohydrate) is an amino acid derivative with a Boc protecting group, which can be used to synthesize L-prolyl-L-leucyl-glycinamide peptide, a peptide mimetic with dopamine receptor modulatory activity .

Fmoc-α-Me-Leu-OH	Amino Acid Derivatives	Others
Fmoc-α-Me-Leu-OH is a leucine derivative with an Fmoc protecting group, which can be used to synthesize peptides with oxytocin receptor agonist activity .

Fmoc-L-cysteic acid	Amino Acid Derivatives	Others
Fmoc-L-cysteic acid is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize triarylsulfonium compounds for radiolabeling of peptides .

Fmoc-D-Dab(Boc)-OH	Amino Acid Derivatives	Others
Fmoc-D-Dab(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize peptides with antibacterial activity .

H-GLU-AMC-OH	Fluorescent Dye	Neurological Disease
H-GLU-AMC-OH is an amino acid derivative that can be used as A fluorescent peptide substrate for the determination of aminopeptidase A enzyme activity .

H-Cys-Val-2-Nal-Met-OH	Others	Others
H-Cys-Val-2-Nal-Met-OH is a peptide. H-Cys-Val-2-Nal-Met-OH is a peptidomimetic derivative that can be used to label short peptide sequences .

Ergocristam	Drug Derivative	Others
Ergocristam is an ergot alkaloid derivative. The formation mechanism of ergocristam involves the inversion of the L-proline configuration, which hinders the cyclization of ergot peptides. Ergocristam can be used as a marker to study the synthesis pathway of ergot alkaloids .

Fmoc-Pen(Trt)-OH	Amino Acid Derivatives	Others
Fmoc-Pen(Trt)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize the inhibitory cystine knot (ICK) peptide ProTx-II .

Fmoc-Dap(Boc)-OH	Amino Acid Derivatives	Others
Fmoc-Dap(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bicyclic peptide tachykinin NK2 antagonists .

Boc-L-Arg(Mtr)-OH Boc-Arg(Mtr)-OH	Amino Acid Derivatives	Others
Boc-L-Arg(Mtr)-OH (Boc-Arg(Mtr)-OH) is an amino acid derivative with a Boc protecting group, which can be used to synthesize peptides with antithrombotic activity .

Boc-Gln(Xan)-OH N-Boc-N'-xanthyl-L-glutamine	Amino Acid Derivatives	Others
Boc-Gln(Xan)-OH (N-Boc-N'-xanthyl-L-glutamine) is an amino acid derivative with a Boc protecting group, which can be used to synthesize peptides with antigenic activity .

Fmoc-Pen(Acm)-OH	Amino Acid Derivatives	Others
Fmoc-Pen(Acm)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize chemically modified cyclic peptides containing cell adhesion recognition (CAR) sequences .

Fmoc-5-Ava-OH	Amino Acid Derivatives	Others
Fmoc-5-Ava-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize fatty acid-based dimeric peptides with PSD-95 inhibitory activity .

Fmoc-Oic-OH	Amino Acid Derivatives	Others
Fmoc-Oic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as [desArg ¹⁰]HOE 140, which has bradykinin B1 antagonist activity .

Dynorphin (2-17), amide (porcine)	Endogenous Metabolite Opioid Receptor	Neurological Disease
Dynorphin (2-17), amide (porcine) is a dynorphin derivative with some analgesic effects. Dynorphin is a class of opioid peptides produced by the precursor protein dynorphinogen and is involved in pain, addiction and mood regulation .

Fmoc-D-Tic-OH	Amino Acid Derivatives	Others
Fmoc-D-Tic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as [desArg ¹⁰]HOE 140, which has bradykinin B1 antagonist activity .

Boc-β-Ala-ol 3-(Boc-amino)-1-propanol	Amino Acid Derivatives	Others
Boc-β-Ala-ol (3-(Boc-amino)-1-propanol) is an alanine derivative with a Boc protecting group at the N-terminus, which can be used to synthesize bioactive peptide mimics, such as Nα-Benzoyl-α-azaornithine phenyl ester, which has trypsin inhibitory activity .

Fmoc-Asp(OtBu)-OH 4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate; Fmoc-L-Asp(OtBu)-OH	Amino Acid Derivatives	Others
Fmoc-Asp(OtBu)-OH (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate) is an aspartate derivative containing amine protecting group Fmoc. Fmoc-Asp(OtBu)-OH can be used for peptide synthesis .

Fmoc-Arg(Pbf)-OH	Amino Acid Derivatives Biochemical Assay Reagents	Metabolic Disease
Fmoc-Arg(Pbf)-OH is an arginine derivative containing amine protecting group Fmoc. Fmoc-Arg(Pbf)-OH is a building block for the introduction of Arg into SPPS (Solid-Phase Peptide Synthesis) .

Fmoc-Trp(Me)-OH	Amino Acid Derivatives	Others
Fmoc-Trp (Me)-OH is an amino acid derivative. Fmoc-Trp (Me)-OH is a compound formed by introducing a methyl group into the nitrogen atom (N-1 position) of the indole ring of tryptophan (Trp) and protecting the amino group with an Fmoc (9-fluorenylmethoxycarbonyl) group. Fmoc-Trp (Me)-OH can be used for protein or peptide synthesis .

7-Methyl-DL-tryptophan 7-Methyltryptophan	Amino Acid Derivatives	Infection
7-Methyl-DL-tryptophan (7-Methyltryptophan) is an amino acid derivative, which is a key precursor for biosynthesis of many non-ribosomal peptide antibiotics. 7-Methyl-DL-tryptophan plays an important role in synthesis of high-efficiency antibacterial agents and analogues thereof .

Fmoc-D-4-Aph(cBm)-OH	Amino Acid Derivatives	Others
Fmoc-D-4-Aph(cBm)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize biologically active peptide mimetics, such as Ac-D2Nal-D4Cpa-D3Pal-Ser-4Aph/4Amf(P)-D4Aph/D4Amf(Q)-Leu-ILys-Pro-DAla-NH2 with gonadotropin-releasing hormone (GnRH) antagonist activity .

EB1 peptide Penetrating analog	Amino Acid Derivatives	Others
EB1 peptide (Penetrating analog), a Penetratin peptide derivative, is an amphipathic cell-penetrating peptide (CPP). EB1 peptide has the potential for intracellular drug delivery research .

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GCGR	Metabolic Disease
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Exendin derivative 1	Drug Derivative	Others
Exendin derivative 1 is a 39 amino acid peptide.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GCGR	Metabolic Disease
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Cbz-D-Leu-Val-Boc	Biochemical Assay Reagents	Cancer
Cbz-D-Leu-Val-Boc is a peptide derivative.

Fmoc-D-3,3-diphenylalanine	Amino Acid Derivatives	Others
Fmoc-D-3,3-diphenylalanine is a peptide derivative.

(Leu31,Pro34)-Peptide YY (human)	Neuropeptide Y Receptor	Neurological Disease
(Leu31,Pro34)-Peptide YY (human) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y₁ agonist with a K_D of 1.0 nM .

[3,5 Diiodo-Tyr7] Peptide T	Amino Acid Derivatives	Others
[3,5 Diiodo-Tyr7] Peptide T is a threonine derivative .

L-Homotyrosine	Drug Derivative	Others
L-Homotyrosine is a tyrosine derivative that can be used for solid-phase peptide synthesis .

Exendin-3/4 (59-86)	GCGR	Metabolic Disease
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.

p-Diazobenzoyl-biocytin chloride DBB chloride	Biochemical Assay Reagents	Others
p-Diazobenzoyl-biocytin chloride is a biotin derivative that can be used for the labeling of tyrosine and histidines in peptides and proteins .

H-L-Cys(MDNPE)-OH hydrochloride	Amino Acid Derivatives	Others
H-L-Cys(MDNPE)-OH hydrochloride is a cysteine derivative with a short peptide sequence attached to the thiol group of cysteine.

Boc-D-norleucine Boc-D-Nle-OH; N-BOC-D-norleucine	Amino Acid Derivatives	Others
Boc-D-norleucine (Boc-D-Nle-OH) is a leucine derivative that can be used for peptide synthesis .

(Leu31,Pro34)-Peptide YY (human) (TFA)	Neuropeptide Y Receptor	Neurological Disease
(Leu31,Pro34)-Peptide YY (human) (TFA) is the TFA form of (Leu31,Pro34)-Peptide YY (human) (HY-P3877). (Leu31,Pro34)-Peptide YY (human) (TFA) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y₁ agonist with a K_D of 1.0 nM .

Fmoc-L-Homoarginine hydrochloride	Amino Acid Derivatives	Others
Fmoc-L-Homoarginine hydrochloride is a derivative of amino acid with protecting groups. Fmoc-L-Homoarginine hydrochloride can be used for synthesis of homoarginine containing peptide .

Fmoc-Ala-Thr(psi(Me,Me)pro)-OH	Amino Acid Derivatives	Others
Fmoc-Ala-Thr(psi(Me,Me))-OH is an Fmoc protected alanine derivative and can be used for peptide synthesis.

Omiganan, FITC labeled	Bacterial Fungal	Infection
Omiganan, FITC labeled is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections. FITC is a derivative of fluorescein for the labeling of amines .

Fmoc-D-Cit-OH	Amino Acid Derivatives	Others
Fmoc-D-Cit-OH is citrulline with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as H-Dmt-D-Cit-Aba-b-Ala-NMe-30,50-(CF3)2-Bn and H-Dmt-D-Cit-Aba-b-Ala-NMe-Bn with neurokinin-1 antagonist activity .

αs1-CN f(143–149)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
αs1-CN f(143–149) is an orally active casein-derived peptide sequence. αs1-CN f(143–149) exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC₅₀=6.58 μM) and antihypertensive activity .

Boc-L-proline	Amino Acid Derivatives Biochemical Assay Reagents Drug Intermediate	Others
Boc-L-proline is an amino acid derivative. As an important intermediate in organic synthesis, Boc-L-proline can be used for peptide synthesis .

N-Fmoc-O-ethyl-L-homoserine	Amino Acid Derivatives	Others
N-Fmoc-O-ethyl-L-homoserine is an homoserine derivative, can be used in cyclic peptide compounds synthesis, as a reducing reagent .

Cat. No.	Product Name

HY-L105

Peptide Library

1,986 compounds

Peptides are a group of biologically active substances that are involved in various cellular functions of organisms. Peptides are often used in functional analysis, vaccine research and especially in the field of drug research and development. At present, more than 80 peptide drugs have reached the market for a wide range of diseases, including diabetes, cancer, osteoporosis, multiple sclerosis, HIV infection and chronic pain.

MedChemExpress (MCE) offers a comprehensive collection of 1,986 peptides, including bioactive peptides, amino acid derivatives, and blocking peptides. MCE Peptide Library can be used for peptide library screening, peptide drug discovery, vaccine development, target verification, structural activity research, etc.

Cat. No.	Product Name	Type

HY-D1085

AMCA-X SE	Fluorescent Dyes/Probes
AMCA-X-SE is a coumarin derivative that generates fixed blue fluorescence and an NHS-activated ester that forms stable amide bonds with primary amine groups. It is used as a reactive dye for labeling amino groups of peptides, proteins, and oligonucleotides. Maximum excitation/emission wavelength: 354/442 nm .

HY-W027544

MCA 7-Methoxycoumarin-4-acetic acid	Fluorescent Dyes/Probes
MCA (7-Methoxycoumarin-4-acetic acid) is a Coumarin (HY-N0709) derivative. MCA quantitates platelet-activating factor (PAF) by high-performance liquid chromatography with fluorescent detection. MCA can modify FRET peptide substrates for analyzing protease activities .

HY-W324458

MCA succinimidyl ester	Fluorescent Dyes/Probes
MCA succinimidyl ester is a derivative of MCA (HY-W027544). MCA succinimidyl ester has succinimidyl ester can react selectively with amines. MCA succinimidyl ester can be used as peptide substrate for fluorescence resonance energy transfer .

HY-149117

AF430 NHS ester	Fluorescent Dyes/Probes
AF430 NHS ester is an AF 430 maleimide is a derivative of the yellow fluorescent dye AF 430. AF430 has an excitation wavelength of 425 nm and an emission wavelength of 542 nm. AF430 NHS ester can be uesd for the labeling of amino-groups in peptides, proteins, and oligonucleotides. To achieve specific coupling of dye labels and biomolecules .

HY-D2772

5-TAMRA Cadaverine

Fluorescent Dyes/Probes

5-TAMRA cadaverine can used to modify carboxylic acid group in the presence of activators (e.g. EDC, or DCC) or activated esters (e.g. NHS esters) through a stable amide bond. It also can be reversibly coupled to aldehydes and ketones to form a Schiff base – which can be reduced to a generate stable amine derivative by sodium borohydride (NaBH4) or sodium cyanoborohydride (NaCNH3). Although the mixed isomers of 5(6)-TAMRA cadaverine is a preferred, routinely used orange-fluorescent dye for staining proteins, it is rearly used for labeling peptides and nucleotides. Purification of 5(6)-TAMRA labeled peptide and nucleotides might be troublesome due to significant signal broadening in HPLC purification. Peptides and nucleotides labeled with a single isomer TAMRA usually give better resolution in HPLC purification that is often required in the conjugation processes.

HY-D2152

Cy5-PEG3-SCO	Fluorescent Dyes/Probes
Cy5-PEG3-SCO is a dye derivative of Cyanine 5 (Cy5) (HY-D0821) containing 3 PEG units. Cy5-PEG3-SCO has a SCO group that can be covalently bonded to the amino group. SCO is often used to react with amino acid residues of proteins or peptides, particularly lysine.

HY-D2758

TAMRA DBCO, 5-isomer

Fluorescent Dyes/Probes

TAMRA DBCO, 5-isomer is a derivative of tetramethylrhodamine (TMR, TAMRA) containing a cyclooctyne moiety (dibenzocyclooctyne, DBCO). Pure 5-isomer. DBCO reacts quickly and efficiently with azides by simply mixing the components without the need for a copper catalyst (so-called sterically promoted cycloaddition reaction (SPAAC)). TAMRA DBCO can be used for the labeling of proteins, peptides, nucleic acids, and other molecules containing azide groups.

HY-D2122

Cy3-PEG2-SCO	Fluorescent Dyes/Probes
Cy3-PEG2-SCO is a dye derivative of Cyanine 3 (Cy3) (HY-D0822) containing 2 PEG units. Cy3-PEG2-SCO carries a SCO group that can be covalently bound to an amino group. SCO is often used to react with amino acid residues of proteins or peptides, particularly lysine.

HY-D2158

Cy5-PEG7-SCO	Fluorescent Dyes/Probes
Cy5-PEG7-SCO is a dye derivative of Cyanine 5 (Cy5) (HY-D0821) containing 7 PEG units. Cy5-PEG7-SCO has a SCO group that can be covalently bonded to the amino group. SCO is often used to react with amino acid residues of proteins or peptides, particularly lysine.

HY-D1848

Sulfo-Cy3-NHS disodium	Fluorescent Dyes/Probes
Sulfo-Cy3-NHS disodium is a derivative of Cy3 (Cyanine3) (HY-D0822) dye containing sulfonate ions. Sulfo-Cy3-NHS disodium contains sulfonate ions and has improved water solubility. Sulfo-Cy3-NHS disodium can label biomolecules containing amine groups, such as proteins, antibodies or peptides.

HY-D2153

Cy5-PEG2-SCO	Fluorescent Dyes/Probes
Cy5-PEG2-SCO is a dye derivative of Cyanine 5 (Cy5) (HY-D0821) containing 2 PEG units. Cy5-PEG2-SCO has a SCO group that can be covalently bonded to the amino group. SCO is often used to react with amino acid residues of proteins or peptides, particularly lysine.

HY-D2124

Cy3-PEG7-SCO	Fluorescent Dyes/Probes
Cy3-PEG7-SCO is a dye derivative of Cyanine 3 (Cy3) (HY-D0822) containing 7 PEG units. Cy3-PEG7-SCO has a SCO group that can be covalently bonded to the amino group. SCO is often used to react with amino acid residues of proteins or peptides, particularly lysine.

HY-D1848A

Sulfo-Cy3-NHS ditriethylamine	Fluorescent Dyes/Probes
Sulfo-Cy3-NHS ditriethylamine is a derivative of Cy3 (Cyanine3) (HY-D0822) dye containing sulfonate ions. Sulfo-Cy3-NHS ditriethylamine contains sulfonate ions and has improved water solubility. Sulfo-Cy3-NHS ditriethylamine can label biomolecules containing amine groups, such as proteins, antibodies or peptides.

HY-13631EG

Deruxtecan (GMP) MC-GGFG-DXD (GMP)	Fluorescent Dye
Deruxtecan (GMP) (MC-GGFG-DXD (GMP)) is Deruxtecan (HY-13631E) in GMP grade. GMP-grade small molecules can be used as auxiliary reagents in cell therapy. Deruxtecan is an ADC drug-linker conjugate composed of an DX-8951 derivative (DXd) and a maleimide-GGFG peptide linker, used for synthesizing Trastuzumab deruxtecan (HY-138298A) and Patritumab deruxtecan (HY-P99813) .

HY-D1653

BDP 581/591 NHS ester

Fluorescent Dyes/Probes

BDP 581/591 NHS ester is a a borondipyrromethene dye (Ex=585 nm, Em=594 nm) that has relatively long fluorescence lifetime and two photon excitation cross section. BDP 581/591 NHS ester can be used for fluorescence polarization analysis and also reacts with reactive oxygen species (ROS) and alter fluorescence. BDP 581/591 NHS ester is also an NHS ester derivative that can be used to bind primary and secondary amine groups of proteins, peptides and other molecules.

HY-66019

FITC

60+ Cited Publications

Fluorescein 5-isothiocyanate

Fluorescent Dyes/Probes

FITC (Fluorescein Isothiocyanate), is one of the green fluorescein derivatives widely used in biology. FITC has the characteristics of high absorptivity and excellent fluorescence quantum yield. The isothiocyanate group of FITC can be combined with amino, sulfhydryl, imidazole, tyrosyl, carbonyl and other groups on the protein, so as to achieve protein labeling including antibodies and lectins. In addition to its use as a protein marker, FITC can also be used as a fluorescent protein tracer to rapidly identify pathogens by labeling antibodies, or for microsequencing of proteins and peptides (HPLC). The maximum excitation wavelength of FITC is 494 nm. Once excited, it fluoresces yellow-green at a maximum emission wavelength of 520 nm. In addition, FITC is also a hapten that can induce contact hypersensitivity (CHS) and induce an atopic dermatitis model .

Cat. No.	Product Name	Type

HY-40114

Boc-L-proline	Biochemical Assay Reagents
Boc-L-proline is an amino acid derivative. As an important intermediate in organic synthesis, Boc-L-proline can be used for peptide synthesis .

HY-W1048855B

4-Arm PEG-SCM (MW 10000)	Drug Delivery
4-Arm PEG-SCM (MW 10000) is a multi-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-156144

p-Diazobenzoyl-biocytin chloride DBB chloride	Gene Sequencing and Synthesis
p-Diazobenzoyl-biocytin chloride is a biotin derivative that can be used for the labeling of tyrosine and histidines in peptides and proteins .

HY-174959A

6-Arm-PEG-NHS (MW 600)	Drug Delivery
6-Arm-PEG-NHS (MW 600) is a six-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-W1048512B

2-Arm PEG-NHS (MW 40000)	Drug Delivery
2-Arm PEG-NHS (MW 40000) is a multi-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-W1048512A

2-Arm PEG-NHS (MW 20000)	Drug Delivery
2-Arm PEG-NHS (MW 20000) is a multi-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-174959H

6-Arm-PEG-NHS (MW 10000)	Drug Delivery
6-Arm-PEG-NHS (MW 10000) is a six-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-W1048855D

4-Arm PEG-SCM (MW 40000)	Drug Delivery
4-Arm PEG-SCM (MW 40000) is a multi-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-174959C

6-Arm-PEG-NHS (MW 2000)	Drug Delivery
6-Arm-PEG-NHS (MW 2000) is a six-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-W1048512C

2-Arm PEG-NHS (MW 5000)	Drug Delivery
2-Arm PEG-NHS (MW 5000) is a multi-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-W1048855C

4-Arm PEG-SCM (MW 20000)	Drug Delivery
4-Arm PEG-SCM (MW 20000) is a multi-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-174959B

6-Arm-PEG-NHS (MW 1000)	Drug Delivery
6-Arm-PEG-NHS (MW 1000) is a six-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-W1048855A

4-Arm PEG-SCM (MW 5000)	Drug Delivery
4-Arm PEG-SCM (MW 5000) is a multi-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-174959

6-Arm-PEG-NHS (MW 400)	Drug Delivery
6-Arm-PEG-NHS (MW 400) is a six-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-174959D

6-Arm-PEG-NHS (MW 3400)	Drug Delivery
6-Arm-PEG-NHS (MW 3400) is a six-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-W007618

Boc-Lys-OH	Amino acids and Derivatives
Boc-Lys-OH is an amino acid derivative. Boc-Lys-OH plays a key role in peptide synthesis and redox activity research .

HY-W1048512D

2-Arm PEG-NHS (MW 10000)	Drug Delivery
2-Arm PEG-NHS (MW 10000) is a multi-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-174959E

6-Arm-PEG-NHS (MW 5000)	Drug Delivery
6-Arm-PEG-NHS (MW 5000) is a six-arm PEG derivative that can be used for peptide modification and drug delivery .

HY-138134

NOTP	Chelators
NOTPis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NOTP can be used for conjugation of peptides and radionuclides.

HY-W1049091E

mPEG-Alkyne (MW 3400)	Drug Delivery
mPEG-Alkyne (MW 3400) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049091A

mPEG-Alkyne (MW 5000)	Drug Delivery
mPEG-Alkyne (MW 5000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049091B

mPEG-Alkyne (MW 10000)	Drug Delivery
mPEG-Alkyne (MW 10000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049091D

mPEG-Alkyne (MW 40000)	Drug Delivery
mPEG-Alkyne (MW 40000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049105

mPEG-Alkyne (MW 2000)	Drug Delivery
mPEG-Alkyne (MW 2000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049091

mPEG-Alkyne (MW 1000)	Drug Delivery
mPEG-Alkyne (MW 1000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049091C

mPEG-Alkyne (MW 20000)	Drug Delivery
mPEG-Alkyne (MW 20000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-134418A

NOTA trihydrochloride	Chelators
NOTA (trihydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NOTA (trihydrochloride) can be used for conjugation of peptides and radionuclides.

HY-138269A

Barzuxetan hydrochloride CHX-A''-DTPA-NCS hydrochloride	Chelators
Barzuxetan (hydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. Barzuxetan (hydrochloride) can be used for conjugation of peptides and radionuclides.

HY-W088413

DOTA-amide	Chelators
DOTA-amideis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DOTA-amide can be used for conjugation of peptides and radionuclides.

HY-W020780D

mPEG-Mal (MW 40000)	Drug Delivery
mPEG-Mal (MW 40000) is a thiol-reactive PEG derivative that can be used to selectively modify proteins, peptides, or any other surface with available thiol groups .

HY-W678394

DOTA-Thiol	Chelators
DOTA-Thiolis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DOTA-Thiol can be used for conjugation of peptides and radionuclides.

HY-158067

Deferoxamine-DBCO DFO-DBCO	Chelators
Deferoxamine-DBCOis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DFO derivative used for tumor pre-targeting. Deferoxamine-DBCO can be used for conjugation of peptides and radionuclides.

HY-W782078

Butyne-DOTA	Chelators
Butyne-DOTAis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. Butyne-DOTA can be used for conjugation of peptides and radionuclides.

HY-W591469

mPEG-Mal (MW 1000)	Drug Delivery
mPEG-Mal (MW 1000) is a thiol-reactive PEG derivative that can be used to selectively modify proteins, peptides, or any other surface with available thiol groups .

HY-W835525

N-(Biotinoyl)-N''-(iodoacetyl)ethylenediamine	Biochemical Assay Reagents
N-(Biotinoyl)-N''-(iodoacetyl)ethylenediamine is a biotinylated biochemical assay reagent that forms a layer of biotin derivative on the surface of ORMOCER, and triggers the assembly of peptide nanostructured fibers. N-(Biotinoyl)-N''-(iodoacetyl)ethylenediamine can be used for 3D assembly of peptides in molecular electronics, biosensors, and tissue engineering .

HY-158072

DOTAM-NHS-ester	Chelators
DOTAM-NHS-esteris a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DOTAM-NHS-ester can be used for conjugation of peptides and radionuclides.

HY-W717743

DOTAM-mono-acid	Chelators
DOTAM-mono-acidis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DOTAM-mono-acid can be used for conjugation of peptides and radionuclides.

HY-W717830

CB-Cyclam	Chelators
CB-Cyclamis a bifunctional chelator (Bifunctional Chelator; BFC), which is a main chain Cyclen derivative of the macrocyclic ligand tetradecane. CB-Cyclam can be used for conjugation of peptides and radionuclides.

HY-W539893

NODAGA-tris(t-Bu ester) NODAG	Chelators
NODAGA-tris(t-Bu ester) (NODAG) is a NODAGA derivative. NODAGA-tris(t-Bu ester) can be used to label peptides, antibodies, etc., and subsequently radiolabeled for PET imaging .

HY-W717782

Bz-DTPA hydrochloride	Chelators
Bz-DTPA (hydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. Bz-DTPA (hydrochloride) can be used for conjugation of peptides and radionuclides.

HY-W726767

DO2A	Chelators
DO2Ais a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DO2A can be used for conjugation of peptides and radionuclides.

HY-174359C

Alkyne-PEG-NH2 (MW 5000)	Drug Delivery
Alkyne-PEG-NH2 (MW 5000) is an alkyne-functionalized bifunctional PEG derivative that can be used to modify proteins, peptides, and other materials. The alkyne group reacts with azides in aqueous solution in a copper-catalyzed manner. PEGylation can increase solubility and stability and reduce the immunogenicity of peptides and proteins .

HY-174359D

Alkyne-PEG-NH2 (MW 10000)	Drug Delivery
Alkyne-PEG-NH2 (MW 10000) is an alkyne-functionalized bifunctional PEG derivative that can be used to modify proteins, peptides, and other materials. The alkyne group reacts with azides in aqueous solution in a copper-catalyzed manner. PEGylation can increase solubility and stability and reduce the immunogenicity of peptides and proteins .

HY-174359

Alkyne-PEG-NH2 (MW 1000)	Drug Delivery
Alkyne-PEG-NH2 (MW 1000) is an alkyne-functionalized bifunctional PEG derivative that can be used to modify proteins, peptides, and other materials. The alkyne group reacts with azides in aqueous solution in a copper-catalyzed manner. PEGylation can increase solubility and stability and reduce the immunogenicity of peptides and proteins .

HY-174359B

Alkyne-PEG-NH2 (MW 3400)	Drug Delivery
Alkyne-PEG-NH2 (MW 3400) is an alkyne-functionalized bifunctional PEG derivative that can be used to modify proteins, peptides, and other materials. The alkyne group reacts with azides in aqueous solution in a copper-catalyzed manner. PEGylation can increase solubility and stability and reduce the immunogenicity of peptides and proteins .

HY-174359E

Alkyne-PEG-NH2 (MW 20000)	Drug Delivery
Alkyne-PEG-NH2 (MW 20000) is an alkyne-functionalized bifunctional PEG derivative that can be used to modify proteins, peptides, and other materials. The alkyne group reacts with azides in aqueous solution in a copper-catalyzed manner. PEGylation can increase solubility and stability and reduce the immunogenicity of peptides and proteins .

HY-174359H

Alkyne-PEG-NH2 (MW 40000)	Drug Delivery
Alkyne-PEG-NH2 (MW 40000) is an alkyne-functionalized bifunctional PEG derivative that can be used to modify proteins, peptides, and other materials. The alkyne group reacts with azides in aqueous solution in a copper-catalyzed manner. PEGylation can increase solubility and stability and reduce the immunogenicity of peptides and proteins .

HY-174359A

Alkyne-PEG-NH2 (MW 2000)	Drug Delivery
Alkyne-PEG-NH2 (MW 2000) is an alkyne-functionalized bifunctional PEG derivative that can be used to modify proteins, peptides, and other materials. The alkyne group reacts with azides in aqueous solution in a copper-catalyzed manner. PEGylation can increase solubility and stability and reduce the immunogenicity of peptides and proteins .

HY-W087027A

Maleimide-NOTA TFA	Chelators
Maleimide-NOTA (TFA)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. Maleimide-NOTA (TFA) can be used for conjugation of peptides and radionuclides.

HY-W250844A

DO3A trisodium	Chelators
DO3A (trisodium)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DO3A (trisodium) can be used for conjugation of peptides and radionuclides.

Cat. No.	Product Name	Target	Research Area

HY-W000665

2,6-Dimethyl-L-tyrosine Dmt	Opioid Receptor	Neurological Disease
2,6-Dimethyl-L-tyrosine (Dmt) is a tyrosine derivative that enhances receptor affinity, functional bioactivity and in vivo analgesia of opioid peptides .

HY-W013154

Fmoc-Tic-OH	Amino Acid Derivatives	Others
Fmoc-Tic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as the biotinylated derivative of the opioid receptor antagonist TIPP .

HY-W046355

Fmoc-D-Dap(Boc)-OH	Radionuclide-Drug Conjugates (RDCs) Amino Acid Derivatives	Others
Fmoc-D-Dap(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as DOTA-modified peptides and their metal chelates with cancer diagnostic effects .

HY-W101495

Boc-Leu-OH hydrate N-Boc-L-leucine monohydrate	Amino Acid Derivatives	Others
Boc-Leu-OH hydrate (N-Boc-L-leucine monohydrate) is an amino acid derivative with a Boc protecting group, which can be used to synthesize L-prolyl-L-leucyl-glycinamide peptide, a peptide mimetic with dopamine receptor modulatory activity .

HY-W048739

Fmoc-α-Me-Leu-OH	Amino Acid Derivatives	Others
Fmoc-α-Me-Leu-OH is a leucine derivative with an Fmoc protecting group, which can be used to synthesize peptides with oxytocin receptor agonist activity .

HY-W097054

Fmoc-L-cysteic acid	Amino Acid Derivatives	Others
Fmoc-L-cysteic acid is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize triarylsulfonium compounds for radiolabeling of peptides .

HY-W019032

Fmoc-D-Dab(Boc)-OH	Amino Acid Derivatives	Others
Fmoc-D-Dab(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize peptides with antibacterial activity .

HY-W008876

Fmoc-Pen(Trt)-OH	Amino Acid Derivatives	Others
Fmoc-Pen(Trt)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize the inhibitory cystine knot (ICK) peptide ProTx-II .

HY-W010922

Fmoc-Dap(Boc)-OH	Amino Acid Derivatives	Others
Fmoc-Dap(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bicyclic peptide tachykinin NK2 antagonists .

HY-W077219

Boc-L-Arg(Mtr)-OH Boc-Arg(Mtr)-OH	Amino Acid Derivatives	Others
Boc-L-Arg(Mtr)-OH (Boc-Arg(Mtr)-OH) is an amino acid derivative with a Boc protecting group, which can be used to synthesize peptides with antithrombotic activity .

HY-W101889

Boc-Gln(Xan)-OH N-Boc-N'-xanthyl-L-glutamine	Amino Acid Derivatives	Others
Boc-Gln(Xan)-OH (N-Boc-N'-xanthyl-L-glutamine) is an amino acid derivative with a Boc protecting group, which can be used to synthesize peptides with antigenic activity .

HY-W101305

Fmoc-Pen(Acm)-OH	Amino Acid Derivatives	Others
Fmoc-Pen(Acm)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize chemically modified cyclic peptides containing cell adhesion recognition (CAR) sequences .

HY-W009118

Fmoc-5-Ava-OH	Amino Acid Derivatives	Others
Fmoc-5-Ava-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize fatty acid-based dimeric peptides with PSD-95 inhibitory activity .

HY-W041989

Fmoc-Oic-OH	Amino Acid Derivatives	Others
Fmoc-Oic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as [desArg ¹⁰]HOE 140, which has bradykinin B1 antagonist activity .

HY-P3625

Dynorphin (2-17), amide (porcine)	Endogenous Metabolite Opioid Receptor	Neurological Disease
Dynorphin (2-17), amide (porcine) is a dynorphin derivative with some analgesic effects. Dynorphin is a class of opioid peptides produced by the precursor protein dynorphinogen and is involved in pain, addiction and mood regulation .

HY-W013153

Fmoc-D-Tic-OH	Amino Acid Derivatives	Others
Fmoc-D-Tic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as [desArg ¹⁰]HOE 140, which has bradykinin B1 antagonist activity .

HY-34738

Boc-β-Ala-ol 3-(Boc-amino)-1-propanol	Amino Acid Derivatives	Others
Boc-β-Ala-ol (3-(Boc-amino)-1-propanol) is an alanine derivative with a Boc protecting group at the N-terminus, which can be used to synthesize bioactive peptide mimics, such as Nα-Benzoyl-α-azaornithine phenyl ester, which has trypsin inhibitory activity .

HY-Y1169

Fmoc-Asp(OtBu)-OH 4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate; Fmoc-L-Asp(OtBu)-OH	Amino Acid Derivatives	Others
Fmoc-Asp(OtBu)-OH (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate) is an aspartate derivative containing amine protecting group Fmoc. Fmoc-Asp(OtBu)-OH can be used for peptide synthesis .

HY-Y1636

Fmoc-Arg(Pbf)-OH	Amino Acid Derivatives Biochemical Assay Reagents	Metabolic Disease
Fmoc-Arg(Pbf)-OH is an arginine derivative containing amine protecting group Fmoc. Fmoc-Arg(Pbf)-OH is a building block for the introduction of Arg into SPPS (Solid-Phase Peptide Synthesis) .

HY-W142073

7-Methyl-DL-tryptophan 7-Methyltryptophan	Amino Acid Derivatives	Infection
7-Methyl-DL-tryptophan (7-Methyltryptophan) is an amino acid derivative, which is a key precursor for biosynthesis of many non-ribosomal peptide antibiotics. 7-Methyl-DL-tryptophan plays an important role in synthesis of high-efficiency antibacterial agents and analogues thereof .

HY-W044285

Fmoc-D-4-Aph(cBm)-OH	Amino Acid Derivatives	Others
Fmoc-D-4-Aph(cBm)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize biologically active peptide mimetics, such as Ac-D2Nal-D4Cpa-D3Pal-Ser-4Aph/4Amf(P)-D4Aph/D4Amf(Q)-Leu-ILys-Pro-DAla-NH2 with gonadotropin-releasing hormone (GnRH) antagonist activity .

HY-P4118

EB1 peptide Penetrating analog	Amino Acid Derivatives	Others
EB1 peptide (Penetrating analog), a Penetratin peptide derivative, is an amphipathic cell-penetrating peptide (CPP). EB1 peptide has the potential for intracellular drug delivery research .

HY-P1231

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GCGR	Metabolic Disease
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

HY-P1157

Exendin derivative 1	Drug Derivative	Others
Exendin derivative 1 is a 39 amino acid peptide.

HY-P1229

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GCGR	Metabolic Disease
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

HY-400312

Cbz-D-Leu-Val-Boc	Biochemical Assay Reagents	Cancer
Cbz-D-Leu-Val-Boc is a peptide derivative.

HY-W008922

Fmoc-D-3,3-diphenylalanine	Amino Acid Derivatives	Others
Fmoc-D-3,3-diphenylalanine is a peptide derivative.

HY-P3877

(Leu31,Pro34)-Peptide YY (human)	Neuropeptide Y Receptor	Neurological Disease
(Leu31,Pro34)-Peptide YY (human) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y₁ agonist with a K_D of 1.0 nM .

HY-P3994

[3,5 Diiodo-Tyr7] Peptide T	Amino Acid Derivatives	Others
[3,5 Diiodo-Tyr7] Peptide T is a threonine derivative .

HY-P1223

Exendin-3/4 (59-86)	GCGR	Metabolic Disease
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.

HY-41912B

Boc-D-norleucine Boc-D-Nle-OH; N-BOC-D-norleucine	Amino Acid Derivatives	Others
Boc-D-norleucine (Boc-D-Nle-OH) is a leucine derivative that can be used for peptide synthesis .

HY-P3877A

(Leu31,Pro34)-Peptide YY (human) (TFA)	Neuropeptide Y Receptor	Neurological Disease
(Leu31,Pro34)-Peptide YY (human) (TFA) is the TFA form of (Leu31,Pro34)-Peptide YY (human) (HY-P3877). (Leu31,Pro34)-Peptide YY (human) (TFA) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y₁ agonist with a K_D of 1.0 nM .

HY-W338516

Fmoc-L-Homoarginine hydrochloride	Amino Acid Derivatives	Others
Fmoc-L-Homoarginine hydrochloride is a derivative of amino acid with protecting groups. Fmoc-L-Homoarginine hydrochloride can be used for synthesis of homoarginine containing peptide .

HY-P4762

(TYR34)-PTH (7-34) AMIDE (BOVINE)	Peptides	Others
(TYR34)-PTH (7-34) AMIDE (BOVINE) is a peptide derivative of Parathyroid Hormone (PTH) .

HY-P2392

Fmoc-Ala-Thr(psi(Me,Me)pro)-OH	Amino Acid Derivatives	Others
Fmoc-Ala-Thr(psi(Me,Me))-OH is an Fmoc protected alanine derivative and can be used for peptide synthesis.

HY-P2292

Omiganan, FITC labeled	Bacterial Fungal	Infection
Omiganan, FITC labeled is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections. FITC is a derivative of fluorescein for the labeling of amines .

HY-138106

Fmoc-D-Cit-OH	Amino Acid Derivatives	Others
Fmoc-D-Cit-OH is citrulline with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as H-Dmt-D-Cit-Aba-b-Ala-NMe-30,50-(CF3)2-Bn and H-Dmt-D-Cit-Aba-b-Ala-NMe-Bn with neurokinin-1 antagonist activity .

HY-P10601

αs1-CN f(143–149)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
αs1-CN f(143–149) is an orally active casein-derived peptide sequence. αs1-CN f(143–149) exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC₅₀=6.58 μM) and antihypertensive activity .

HY-W036160

N-Fmoc-O-ethyl-L-homoserine	Amino Acid Derivatives	Others
N-Fmoc-O-ethyl-L-homoserine is an homoserine derivative, can be used in cyclic peptide compounds synthesis, as a reducing reagent .

HY-W562116

Boc-Lys(ivdde)-OH	Amino Acid Derivatives	Others
Boc-Lys(ivdde)-OH is a derivative of amino acid. Boc-Lys(ivdde)-OH can be used for synthesis of lysine containing peptide .

HY-W419374

ivDde-Lys(Fmoc)-OH	Amino Acid Derivatives	Others
ivDde-Lys(Fmoc)-OH is a derivative of amino acid with protecting groups. ivDde-Lys(Fmoc)-OH can be used for peptide synthesis .

HY-W007618

Boc-Lys-OH	Amino Acid Derivatives Biochemical Assay Reagents Drug Intermediate	Others
Boc-Lys-OH is an amino acid derivative. Boc-Lys-OH plays a key role in peptide synthesis and redox activity research .

HY-P5517

SNNF(N-Me)GA(N-Me)ILSS	Peptides	Others
SNNF(N-Me)GA(N-Me)ILSS is a biological active peptide. (Double N-methylated derivatives of amyloidogenic and cytotoxic partial IAPP sequence)

HY-114161

H-Val-Pro-Pro-OH 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-P5516

SNNF(N-Me)GA(N-Me)IL	Peptides	Others
SNNF(N-Me)GA(N-Me)IL is a biological active peptide. (Double N-methylated derivatives of amyloidogenic and cytotoxic partial IAPP sequence)

HY-W002450

L-Cyclohexylalanine	Drug Derivative	Cardiovascular Disease
L-Cyclohexylalanine is an amino acid derivative. L-Cyclohexylalanine modifies an atrial natriuretic peptide, regulates homeostasis of body fluid and blood pressure homeostasis and vasodilation activity .

HY-114161A

H-Val-Pro-Pro-OH TFA 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-W109214

Fmoc-L-Dap(Boc,Me)-OH	Amino Acid Derivatives	Others
Fmoc-L-Dap(Boc,Me)-OH is a derivative of amino acid with protecting groups. Fmoc-L-Dap(Boc,Me)-OH can be used for synthesis of diaminopropionic acid containing peptide .

HY-P2218

Anditixafortide	Radionuclide-Drug Conjugates (RDCs) CXCR	Cancer
Anditixafortide (Pentixather) is an endoradiotherapeutic vector. Anditixafortide is a CXCR4-targeting peptide derivative . Anditixafortide can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).

HY-W337644

Fmoc-L-Homoarg(Et)2-OH hydrochloride	Amino Acid Derivatives	Others
Fmoc-L-Homoarg(Et)2-OH hydrochloride is a derivative of amino acid with protecting groups. Fmoc-L-Dap(Boc,Me)-OH can be used for synthesis of homoarginine containing peptide .

Cat. No.	Product Name

HY-K0219

High-Affinity Iodoacetyl Agarose 1 Publications Verification
MCE High-Affinity Iodoacetyl Agarose, a 4% highly cross-linked agarose reagent coupled with a derivative of iodoacetic acid, is ideal for conjugating sulfhydryl-containing peptide or protein for subsequent affinity purification.

Cat. No.	Product Name	Chemical Structure

HY-W101495S

Boc-Leu-OH·H2O-13C
Boc-Leu-OH·H₂O- ¹³C is a ¹³C-labeled Boc-Leu-OH (HY-W101495). Boc-Leu-OH hydrate (N-Boc-L-leucine monohydrate) is an amino acid derivative with a Boc protecting group, which can be used to synthesize L-prolyl-L-leucyl-glycinamide peptide, a peptide mimetic with dopamine receptor modulatory activity .

HY-13631ES4

Deruxtecan-d5
Deruxtecan-d₅ is deuterium labeled Deruxtecan (HY-13631E). Deruxtecan is an ADC drug-linker conjugate composed of an DX-8951 derivative (DXd) and a maleimide-GGFG peptide linker, used for synthesizing DS-8201 and U3-1402.

HY-13631ES

Deruxtecan-d4
Deruxtecan-d₄ is deuterium labeled Deruxtecan (HY-13631E). Deruxtecan is an ADC drug-linker conjugate composed of an DX-8951 derivative (DXd) and a maleimide-GGFG peptide linker, used for synthesizing DS-8201 and U3-1402.

HY-13631ES3

Deruxtecan-d2
Deruxtecan-d₂ is the deuterium labeled Deruxtecan (HY-13631E) . Deruxtecan is an ADC drug-linker conjugate composed of an DX-8951 derivative (DXd) and a maleimide-GGFG peptide linker, used for synthesizing DS-8201 and U3-1402.

HY-13631ES2

Deruxtecan-d4-1
Deruxtecan-d₄-1 is the deuterium labeled Adenosine Deruxtecan (HY-13631E) . Deruxtecan is an ADC drug-linker conjugate composed of an DX-8951 derivative (DXd) and a maleimide-GGFG peptide linker, used for synthesizing DS-8201 and U3-1402.

HY-Y1636S1

Fmoc-Arg(Pbf)-OH-13C6
Fmoc-Arg(Pbf)-OH- ¹³C₆ is the ¹³C labeled Fmoc-Arg(Pbf)-OH . Fmoc-Arg(Pbf)-OH is an arginine derivative containing amine protecting group Fmoc. Fmoc-Arg(Pbf)-OH is a building block for the introduction of Arg into SPPS (Solid-Phase Peptide Synthesis) .

HY-Y1169S1

Fmoc-Asp(OtBu)-OH-13C4,15N
Fmoc-Asp(OtBu)-OH- ¹³C₄, ¹⁵N is the ¹³C and ¹⁵N labeled Fmoc-Asp(OtBu)-OH . Fmoc-Asp(OtBu)-OH (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate) is a aspartate derivative containing amine protecting group Fmoc. Fmoc-Asp(OtBu)-OH can be used for peptide synthesis .

HY-W027544S

MCA-d3
MCA-d₃ (7-Methoxycoumarin-4-acetic acid₃) is the deuterium labeled MCA (HY-W027544) . MCA is a Coumarin (HY-N0709) derivative. MCA quantitates platelet-activating factor (PAF) by high-performance liquid chromatography with fluorescent detection. MCA can modify FRET peptide substrates for analyzing protease activities .

HY-Y1636S

Fmoc-Arg(Pbf)-OH-13C6,15N4
Fmoc-Arg(Pbf)-OH- ¹³C₆, ¹⁵N₄ is the ¹³C-labeled and ¹⁵N-labeled Fmoc-Arg(Pbf)-OH (HY-Y1636). Fmoc-Arg(Pbf)-OH is an arginine derivative containing amine protecting group Fmoc. Fmoc-Arg(Pbf)-OH is a building block for the introduction of Arg into SPPS (Solid-Phase Peptide Synthesis) .

HY-Y1169S2

Fmoc-Asp(OtBu)-OH-d3
Fmoc-Asp(OtBu)-OH-d₃ (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate-d₃) is deuterium labeled Fmoc-Asp(OtBu)-OH. Fmoc-Asp(OtBu)-OH (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate) is a aspartate derivative containing amine protecting group Fmoc. Fmoc-Asp(OtBu)-OH can be used for peptide synthesis .

HY-W010712S1

Fmoc-His(Trt)-OH-15N3
Fmoc-His(Trt)-OH- ¹⁵N₃ is the ¹⁵N labeled Fmoc-His(Trt)-OH (HY-W010712). Fmoc-His (Trt)-OH is a histidine derivative. Fmoc-His(Trt)-OH has trityl (Trt) group to protect the side-chain of His. Fmoc-His(Trt)-OH has Fmoc group to protect -αNH2. Fmoc-His(Trt)-OH can be used for solid phase synthesis of peptides, providing protection against racemization and by-product formation .

Cat. No.	Product Name		Classification

HY-158067

Deferoxamine-DBCO DFO-DBCO		DBCO
Deferoxamine-DBCOis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DFO derivative used for tumor pre-targeting. Deferoxamine-DBCO can be used for conjugation of peptides and radionuclides.

HY-W782078

Butyne-DOTA		Alkynes
Butyne-DOTAis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. Butyne-DOTA can be used for conjugation of peptides and radionuclides.

HY-W539916

Azido-mono-amide-DOTA		Azide
Azido-mono-amide-DOTAis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. Azido-mono-amide-DOTA can be used for conjugation of peptides and radionuclides.

HY-W1049091E

mPEG-Alkyne (MW 3400)		Alkynes
mPEG-Alkyne (MW 3400) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049091A

mPEG-Alkyne (MW 5000)		Alkynes
mPEG-Alkyne (MW 5000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049091B

mPEG-Alkyne (MW 10000)		Alkynes
mPEG-Alkyne (MW 10000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049091D

mPEG-Alkyne (MW 40000)		Alkynes
mPEG-Alkyne (MW 40000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049105

mPEG-Alkyne (MW 2000)		Alkynes
mPEG-Alkyne (MW 2000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049091

mPEG-Alkyne (MW 1000)		Alkynes
mPEG-Alkyne (MW 1000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W1049091C

mPEG-Alkyne (MW 20000)		Alkynes
mPEG-Alkyne (MW 20000) is a PEG derivative. The alkynyl group can react with azide in aqueous solution under the catalysis of monovalent copper. Polyethylene glycol derivatives can increase the solubility and stability of drugs, reduce the immunogenicity of peptides, and have good biocompatibility .

HY-W749627

NO2A-Butyne		Alkynes
NO2A-Butyneis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NO2A-Butyne can be used for conjugation of peptides and radionuclides.

HY-W451440

Butyne-DOTA-tris(t-butyl ester)		Alkynes
Butyne-DOTA-tris(t-butyl ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. Butyne-DOTA-tris(t-butyl ester) can be used for conjugation of peptides and radionuclides.

HY-W717800A

NO2A-Azide trihydrochloride		Azide
NO2A-Azide (trihydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NO2A-Azide (trihydrochloride) can be used for conjugation of peptides and radionuclides.

HY-W749614

NO2A-Butyne-bis(t-Butyl ester)		Alkynes
NO2A-Butyne-bis(t-Butyl ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NO2A-Butyne-bis(t-Butyl ester) can be used for conjugation of peptides and radionuclides.

HY-D2758

TAMRA DBCO, 5-isomer		DBCO
TAMRA DBCO, 5-isomer is a derivative of tetramethylrhodamine (TMR, TAMRA) containing a cyclooctyne moiety (dibenzocyclooctyne, DBCO). Pure 5-isomer. DBCO reacts quickly and efficiently with azides by simply mixing the components without the need for a copper catalyst (so-called sterically promoted cycloaddition reaction (SPAAC)). TAMRA DBCO can be used for the labeling of proteins, peptides, nucleic acids, and other molecules containing azide groups.

HY-151738

Fmoc-Aeg(N3)-OH		Azide
Fmoc-Aeg(N3)-OH is a click chemistry reagent containing an Azide. Alkylating the Nitrogen of an amide bond results in peptoid structures, which leads to conformational restrains, like N-methylation and allows backbone derivatisation. Altering cytotoxicity, bacterial cell selectivity and receptor pharmacology through formation of peptoid derivatives have been published for Cilengitide, Piscidin 1, and MC3, MC4 and MC5 receptor agonist. This building block enables design of macrocycles through intermolecular crosslinking or backbone stabilization through intermolecular ring-closure. This compound is a potential building block for the construction of (customized) peptide nucleic acids (PNAs) and for peptoid synthesis . Fmoc-Aeg(N3)-OH is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.

Cat. No.	Product Name		Classification

HY-148033

Trimethyl chitosan N,N,N-Trimethylchitosan		Polymers
Trimethyl chitosan (N,N,N-Trimethylchitosan) is a multifunctional polymer and a derivative of Chitosan (HY-B2144A). Trimethyl chitosan targets the absorption enhancing proteins of tight junctions of intestinal and mucosal epithelial cells, induces tight junction protein rearrangement, and increases intercellular permeability. Trimethyl chitosan can stimulate the activity of promoting transmembrane transport of hydrophilic drugs (such as peptides and proteins) and can be used for drug delivery and synthesis of nanoparticles .

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

Derivative peptides

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Biochemical Assay Reagents

Peptides

MCE Kits

NaturalProducts

Isotope-Labeled Compounds

Click Chemistry

Oligonucleotides

Natural
Products