Search Result
Results for "
Cys129
" in MedChemExpress (MCE) Product Catalog:
1
Isotope-Labeled Compounds
Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-117430
-
-
-
- HY-P10388
-
|
CD47
TGF-β Receptor
|
Cancer
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
-
-
- HY-P3226
-
|
IGF-1R
|
Metabolic Disease
|
JB-1, an IGF-1 peptide analog, is a selective and potent IGF-1R antagonist. JB-1 competes with IGF-1 by binding the IGF-1 receptor. JB-1 prevents the autophosphorylation of IGF-1R, and has no activity in IGF-II .
|
-
-
- HY-P5533
-
|
Biochemical Assay Reagents
|
Cancer
|
CRT, an iron peptide mimic, can bind to apo-transferrin (apo-Tf). CRT can be used to modify nanoparticles, and enhances drug delivery efficiency .
|
-
-
- HY-P1789A
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
-
- HY-P10557
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
DAG peptide is a cyclic peptide. DAG peptide selectively recognizes a subset of astrocytes that are activated in Alzheimer's disease (AD) starting at an early stage of the disease. DAG peptide can be used as a tool to enhance the delivery of therapeutics and imaging agents to sites of vascular changes and astrogliosis in diseases associated with neuroinflammation .
|
-
-
- HY-P1372
-
|
PKC
|
Others
|
PKC ζ pseudosubstrate, a PKC ζ inhibitor peptide, can be attached to cell permeabilization vector peptide .
|
-
-
- HY-P10693
-
-
-
- HY-P10320
-
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
|
-
-
- HY-P10835
-
|
LAG-3
|
Cancer
|
LAG-3 cyclic peptide inhibitor C25 is a LAG-3 inhibitor. LAG-3 cyclic peptide inhibitor C25 has a high affinity with human LAG-3 protein with a Kd value of 0.66 μM. LAG-3 cyclic peptide inhibitor C25 can block the interaction of LAG-3 with HLA-DR (MHC-II) and activate CD8 + T cells. LAG-3 cyclic peptide inhibitor C25 can be used in the study of cancer .
|
-
-
- HY-P10826
-
|
PD-1/PD-L1
|
Cancer
|
PD-1/PD-L1 inhibitory peptide C8 is inhibits PD-1/PD-L1 interaction, promotes the activation of CD8+ and CD4+ T cells, and increases the IFN-γ secretion. PD-1/PD-L1 inhibitory peptide C8 exhibits antitumor efficacy in mouse model .
|
-
-
- HY-P5322
-
|
Transmembrane Glycoprotein
|
Cardiovascular Disease
Cancer
|
Thrombospondin (TSP-1)-derived CD36 binding motif is a bioactive hexapeptide. Thrombospondin (TSP-1)-derived CD36 binding motif interferes with the interaction between cells and the extracellular matrix by binding to CD36 and angiostatin, thereby affecting the cell adhesion and migration process. Thrombospondin (TSP-1)-derived CD36 binding motif inhibits platelet aggregation. Thrombospondin (TSP-1)-derived CD36 binding motif exerts an anti-tumor effect against colon cancer .
|
-
-
- HY-P2526
-
LyP-1
2 Publications Verification
|
Complement System
|
Cancer
|
LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
-
- HY-P4860
-
|
Akt
Gli
JNK
PKA
|
Metabolic Disease
|
Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway .
|
-
-
- HY-P4205
-
|
Aminopeptidase
|
Cancer
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
-
-
- HY-P4320
-
|
Integrin
|
Cancer
|
Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys (Disulfide bridge: Cys1-Cys10), a decapeptide containing a cyclic RGD active sequence, is an Integrin αIIbβ3 antagonist that inhibits platelet and Adhesion of proMMP-13 .
|
-
-
- HY-P1789
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
-
- HY-P5017
-
|
Oxytocin Receptor
|
Endocrinology
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
-
-
- HY-P1632
-
|
Bacterial
|
Infection
Cancer
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
-
- HY-P1036A
-
|
Complement System
|
Others
|
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
-
- HY-A0182A
-
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
-
-
- HY-P0049A
-
Arg8-vasopressin diacetate; AVP diacetate; ADH
|
Apoptosis
Vasopressin Receptor
|
Neurological Disease
Cancer
|
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
|
-
-
- HY-P1574
-
Vasotocin, Argiprestocin, Arginine vasotocin
|
Oxytocin Receptor
|
Neurological Disease
|
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family .
|
-
-
- HY-P10235
-
|
Amylin Receptor
|
Neurological Disease
|
Cyclic AC253 is an antagonist for amylin receptor, with IC50 of 0.3 μM. Cyclic AC253 exhibits neuroprotective efficacy against Aβ toxicity and abrogates Aβ-induced impairment of hippocampal long-term potentiation. Cyclic AC253 penetrate blood-brain barrier (BBB) .
|
-
-
- HY-P4990A
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
-
- HY-B1811
-
|
Endogenous Metabolite
|
Neurological Disease
|
Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
|
-
-
- HY-P1632A
-
|
Bacterial
|
Infection
Cancer
|
Tachyplesin I TFA is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I TFA exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
-
- HY-P4605
-
-
-
- HY-P5907
-
|
Opioid Receptor
|
Neurological Disease
|
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain .
|
-
-
- HY-P10237
-
|
Calcium Channel
|
Others
|
Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and bone resorption in neonatal rat osteoclasts .
|
-
-
- HY-P3953
-
-
-
- HY-P1036
-
|
Complement System
|
Others
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
-
- HY-P1574A
-
-
-
- HY-P5642
-
RC-101
|
Bacterial
|
Infection
|
Retrocyclin-101 is an antimicrobial peptide against of bacterial and viral .
|
-
-
- HY-P0004
-
-
-
- HY-P4990
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
-
- HY-P10079
-
-
-
- HY-P0049
-
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
-
-
- HY-W539944
-
Arg8-vasopressin acetate; AVP acetate
|
Vasopressin Receptor
Apoptosis
|
Neurological Disease
Cancer
|
Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
|
-
-
- HY-P0090A
-
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
-
-
- HY-P1463A
-
Thyrocalcitonin eel TFA
|
Thyroid Hormone Receptor
|
Others
|
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis .
|
-
-
- HY-A0182
-
-
-
- HY-P0090
-
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
-
-
- HY-P4994
-
-
-
- HY-P4605A
-
-
-
- HY-P1463
-
Thyrocalcitonin eel
|
Thyroid Hormone Receptor
|
Endocrinology
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
-
-
- HY-P2539
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
-
-
- HY-P2538
-
-
-
- HY-P10383
-
|
NO Synthase
|
Infection
|
SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
-
-
- HY-P3512
-
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
Cancer
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
-
- HY-P0256
-
-
- HY-P3563
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
[Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
|
-
- HY-P4191
-
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P0207
-
Endothelin-2 (human, canine); Human endothelin-2
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
-
- HY-P0204
-
-
- HY-P3448
-
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
-
- HY-P4191A
-
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P0202A
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P3433
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
-
- HY-17571F
-
Biotin-α-Hypophamine; Biotin-Oxytocic hormone
|
Oxytocin Receptor
|
Others
|
Biotin-Oxytocin (Biotin-α-Hypophamine; Biotin-Oxytocic hormone) is a biological active peptide. (This is Oxytocin (HY-17571) N-terminally labeled with Biotin.)
|
-
- HY-P5130
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic response in conscious Sprague-Dawley rats. Big endothelin-1 (rat 1-39) raises blood pressure in mice .
|
-
- HY-P10383A
-
|
NO Synthase
|
Infection
|
SPSB2-iNOS inhibitory cyclic peptide-1 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-1(HY-P10383). SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
-
- HY-P0256A
-
Apamine TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Apamin TFA (Apamine TFA) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
-
- HY-P0202
-
-
- HY-P3571
-
|
Endothelin Receptor
|
Cancer
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
-
- HY-P10328
-
|
DNA/RNA Synthesis
|
Metabolic Disease
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
-
- HY-102029
-
SRTX-c
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6c (SRTX-c) is a potent endothelin-B receptor agonist. Sarafotoxin S6c can cause vasoconstriction in both endothelium-intact and endothelium-denuded vessels .
|
-
- HY-P0204A
-
-
- HY-P3565
-
STX-b
|
Calcium Channel
|
Cardiovascular Disease
|
Sarafotoxin S6d (STX-b) is a polypeptide toxin isolated from the venom of the Israeli sand boa constrictor. Sarafotoxin S6d induces multiple electrocardiogram (ECG) changes including myocardial ischemia and hyperkalemia. Sarafotoxin S6d induces strong extracellular calcium-dependent vasoconstriction in rat aorta and exhibits positive inotropic effects in rat atria. Sarafotoxin S6d can be used in the study of cardiovascular diseases .
|
-
- HY-P0207A
-
Endothelin-2 (49-69) (human, canine) TFA; Human endothelin-2 TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
Endothelin-2 (49-69), human (TFA) (Endothelin-2 (49-69) (human, canine) (TFA)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
-
- HY-P5869
-
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
-
- HY-P4678
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
- HY-P3204
-
POT-4
1 Publications Verification
AL-78898A
|
Complement System
|
Metabolic Disease
|
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
|
-
- HY-P5738
-
|
Bacterial
|
Infection
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
-
- HY-P0083
-
POR-8
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Ornipressin (POR-8) is a vasopressin agonist specific for the V1 receptor. Ornipressin can be used as a local vasoconstrictor. Ornipressin can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin has antidiuretic activity. Ornipressin decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
-
- HY-P4678A
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
- HY-P2315
-
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
-
- HY-P0083A
-
POR-8 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Ornipressin (POR-8) acetate is a potent vasoconstrictor, hemostatic and renal agent. Ornipressin acetate is a vasopressin agonist specific for the V1 receptor. Ornipressin acetate can be used as a local vasoconstrictor. Ornipressin acetate can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin acetate has antidiuretic activity. Ornipressin acetate decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
-
- HY-P2496
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P3071
-
Stichodactyla helianthus neurotoxin
|
Potassium Channel
|
Inflammation/Immunology
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
-
- HY-P5010
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
-
- HY-P10924
-
|
Elastase
|
Metabolic Disease
|
Roseltide rT1 is a neutrophil elastase inhibitor (IC50=0.47 μM) rich in cysteine and one of the Roseltide (rT1-rT8) family members. Roseltide rT1 improves cAMP accumulation stimulated by neutrophil elastase in vitro, showing potential for inhibiting related diseases .
|
-
- HY-P0090S
-
Salmon calcitonin-13C6,15N4 TFA
|
CGRP Receptor
|
Metabolic Disease
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
-
- HY-17584A
-
|
Guanylate Cyclase
|
Cancer
|
Linaclotide acetate is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation.
|
-
- HY-P5154
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P10837
-
|
LAG-3
|
Inflammation/Immunology
Cancer
|
LAG-3 cyclic peptide inhibitor 12 (Cyclic peptide 12) is an inhibitor of LAG-3 with an IC50 value of 4.45 μM and a Ki value of 2.66 µM .
|
-
- HY-P5154A
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P3064
-
Leiurotoxin I
|
Potassium Channel
|
Neurological Disease
|
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo .
|
-
- HY-P11071
-
|
PCSK9
|
Cardiovascular Disease
|
PCSK9 Inhibitor, EGF-A is a PCSK9 inhibitor. PCSK9 Inhibitor, EGF-A is residues 293-334 of the EGF-A domain of the low-density lipoprotein (LDL) receptor. PCSK9 Inhibitor, EGF-A can prevent PCSK9-induced intracellular LDLR degradation. PCSK9 Inhibitor, EGF-A can be used in the study of hypercholesterolemia and premature atherosclerosis .
|
-
- HY-161096
-
|
ROR
|
Cancer
|
Antitumor agent-127 (compound 1) is a parent macrocyclic peptide. Antitumor agent-127 displays nanomolar cell-based binding to ROR1 and relatively good internalization in 786-O and MDA-MB-231 tumor cell lines .
|
-
- HY-P1408A
-
|
Integrin
|
Cancer
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
-
- HY-P1408
-
|
Integrin
|
Cancer
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
-
- HY-P5140
-
|
Calcium Channel
|
Metabolic Disease
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
-
- HY-P5162
-
|
Sodium Channel
|
Inflammation/Immunology
|
Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities .
|
-
- HY-P5917A
-
Vaejovis mexicanus peptide 24 TFA
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
Vm24-toxin (Vaejovis mexicanus peptide 24) TFA, a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin TFA shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin TFA folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin TFA attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
-
- HY-P5917
-
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
Vm24-toxin (Vaejovis mexicanus peptide 24), a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
-
- HY-P5568
-
RP 71955
|
HIV
|
Infection
|
RP 71955 is an antimicrobial peptide against HIV-1 .
|
-
- HY-P2005
-
|
Reactive Oxygen Species (ROS)
SOD
|
Others
|
Malformin C is an algicidal peptide can be isolated from Aspergillus and exhibits dose-dependent algicidal activity. Malformin C induces a significant increase in ROS levels in algal cells, resulting in impaired SOD activity and high production of MDA content .
|
-
- HY-P3561A
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-P3561
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-P1206
-
|
Somatostatin Receptor
|
Neurological Disease
|
CH 275 is a peptide analog of somatostatin and binds preferably to somatostatin receptor 1 (sst1) with a Ki of 52 nM . CH 275 acts as a potent and selective sst1 agonist (IC50=30.9 nM) and also displays IC50 values of 345 nM, >1 μM, >10 μM, >10 μM for human sst3, sst4, sst2 and sst5, respectively . CH 275 can be used for the research of alzheimer’s disease .
|
-
- HY-106302
-
Moli1901; Lancovutide
|
Bacterial
|
Infection
Inflammation/Immunology
|
Duramycin (Moli1901) is a lantibiotic derived from Streptomyces cinnamoneuma. Duramycin also is a antimicrobial peptide. Duramycin can be used for the research of cystic fibrosis (CF) .
|
-
- HY-P3215A
-
|
Oxytocin Receptor
|
Endocrinology
|
Oxytocin parallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P10698
-
|
Peptide-Drug Conjugates (PDCs)
LDLR
|
Neurological Disease
|
VH-N412 is a vectorized neuropeptide (NT) with good blood-brain barrier permeability. VH-N412 binds to the low-density lipoprotein receptor (LDLR) and neuropeptide receptor 1 (NTSR-1), and acts as a pharmacological-induced hypothermia (PIH) inducer. VH-N412 exhibits anticonvulsant and neuroprotective effects, and can be used in the study of neurological diseases such as epilepsy.
|
-
- HY-P3215
-
|
Oxytocin Receptor
|
Endocrinology
|
Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P10934
-
LXY2
|
Integrin
|
Cancer
|
LXY3 (LXY2) is a VLA-3-blocking peptide that inhibits the interaction between integrin α3β1 (VLA-3) on neutrophil surfaces and laminin in the basement membrane, thereby preventing neutrophil migration across the tumor vascular basement membrane barrier. LXY3 is used to block neutrophil-mediated nanoparticle release from perivascular pools into the tumor interstitium. LXY3 is commonly employed for targeted imaging of breast cancer .
|
-
- HY-P1955
-
Velcalcetide; AMG 416; KAI-4169
|
CaSR
|
Metabolic Disease
|
Etelcalcetide (AMG 416; KAI-4169) is a synthetic calcimimetic as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis, which is promising for research in the field of secondary hyperparathyroidism and chronic kidney disease .
|
-
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P10388
-
|
CD47
TGF-β Receptor
|
Cancer
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
-
- HY-P3226
-
|
IGF-1R
|
Metabolic Disease
|
JB-1, an IGF-1 peptide analog, is a selective and potent IGF-1R antagonist. JB-1 competes with IGF-1 by binding the IGF-1 receptor. JB-1 prevents the autophosphorylation of IGF-1R, and has no activity in IGF-II .
|
-
- HY-P5533
-
|
Biochemical Assay Reagents
|
Cancer
|
CRT, an iron peptide mimic, can bind to apo-transferrin (apo-Tf). CRT can be used to modify nanoparticles, and enhances drug delivery efficiency .
|
-
- HY-P4916
-
|
Peptides
|
Others
|
Somatostatin-14 (3-14) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P1789A
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P1372
-
|
PKC
|
Others
|
PKC ζ pseudosubstrate, a PKC ζ inhibitor peptide, can be attached to cell permeabilization vector peptide .
|
-
- HY-P10332
-
|
Peptides
|
Others
|
WL 47 dimer (ligand 1) is a caveolin-1 (CAV-1) ligand with high affinity, selectivity and oligomer dissociation activity. WL 47 dimer simultaneously occupies two binding sites of CAV-1, inducing the dissociation of oligomers. WL 47 dimer has 7500-fold improved affinity compared to its T20 parent ligand and an 80% decrease in sequence length. WL 47 dimer can be used to permit targeted study of CAV-1 function .
|
-
- HY-P10693
-
-
- HY-P10320
-
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
|
-
- HY-P10835
-
|
LAG-3
|
Cancer
|
LAG-3 cyclic peptide inhibitor C25 is a LAG-3 inhibitor. LAG-3 cyclic peptide inhibitor C25 has a high affinity with human LAG-3 protein with a Kd value of 0.66 μM. LAG-3 cyclic peptide inhibitor C25 can block the interaction of LAG-3 with HLA-DR (MHC-II) and activate CD8 + T cells. LAG-3 cyclic peptide inhibitor C25 can be used in the study of cancer .
|
-
- HY-P5217
-
|
Peptides
|
Others
|
CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
|
-
- HY-P10557
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
DAG peptide is a cyclic peptide. DAG peptide selectively recognizes a subset of astrocytes that are activated in Alzheimer's disease (AD) starting at an early stage of the disease. DAG peptide can be used as a tool to enhance the delivery of therapeutics and imaging agents to sites of vascular changes and astrogliosis in diseases associated with neuroinflammation .
|
-
- HY-P10826
-
|
PD-1/PD-L1
|
Cancer
|
PD-1/PD-L1 inhibitory peptide C8 is inhibits PD-1/PD-L1 interaction, promotes the activation of CD8+ and CD4+ T cells, and increases the IFN-γ secretion. PD-1/PD-L1 inhibitory peptide C8 exhibits antitumor efficacy in mouse model .
|
-
- HY-P5322
-
|
Transmembrane Glycoprotein
|
Cardiovascular Disease
Cancer
|
Thrombospondin (TSP-1)-derived CD36 binding motif is a bioactive hexapeptide. Thrombospondin (TSP-1)-derived CD36 binding motif interferes with the interaction between cells and the extracellular matrix by binding to CD36 and angiostatin, thereby affecting the cell adhesion and migration process. Thrombospondin (TSP-1)-derived CD36 binding motif inhibits platelet aggregation. Thrombospondin (TSP-1)-derived CD36 binding motif exerts an anti-tumor effect against colon cancer .
|
-
- HY-P2526
-
LyP-1
2 Publications Verification
|
Complement System
|
Cancer
|
LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
- HY-P1487
-
|
Peptides
|
Neurological Disease
|
Pressinoic Acid is a synthetic hexapeptide with potent corticotrophin-releasing activity. Pressinoic Acid is also an oxytocin inhibitor; it induces maternal behavior.
|
-
- HY-P4860
-
|
Akt
Gli
JNK
PKA
|
Metabolic Disease
|
Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway .
|
-
- HY-P4205
-
|
Aminopeptidase
|
Cancer
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
-
- HY-P4320
-
|
Integrin
|
Cancer
|
Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys (Disulfide bridge: Cys1-Cys10), a decapeptide containing a cyclic RGD active sequence, is an Integrin αIIbβ3 antagonist that inhibits platelet and Adhesion of proMMP-13 .
|
-
- HY-P2526A
-
|
Peptides
|
Cancer
|
LyP-1 TFA is a cyclic 9 amino acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
- HY-P1789
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P3222A
-
|
Peptides
|
Endocrinology
|
Oxytocin antiparallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P3222
-
|
Peptides
|
Endocrinology
|
Oxytocin antiparallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P5017
-
|
Oxytocin Receptor
|
Endocrinology
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
-
- HY-P1632
-
|
Bacterial
|
Infection
Cancer
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
- HY-P4184A
-
(Ser4,Ile8)-Oxytocin acetate
|
Peptides
|
Others
|
Isotocin (acetate) ((Ser4,Ile8)-Oxytocin (acetate)) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P1036A
-
|
Complement System
|
Others
|
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-A0182A
-
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
-
- HY-P0049A
-
Arg8-vasopressin diacetate; AVP diacetate; ADH
|
Apoptosis
Vasopressin Receptor
|
Neurological Disease
Cancer
|
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
|
-
- HY-P5166
-
|
Peptides
|
Others
|
Lys-Conopressin-G, a vasotocin-like peptide, can be isolated from the venom of the worm-hunting snail (conus imperialis) .
|
-
- HY-P1574
-
Vasotocin, Argiprestocin, Arginine vasotocin
|
Oxytocin Receptor
|
Neurological Disease
|
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family .
|
-
- HY-P10235
-
|
Amylin Receptor
|
Neurological Disease
|
Cyclic AC253 is an antagonist for amylin receptor, with IC50 of 0.3 μM. Cyclic AC253 exhibits neuroprotective efficacy against Aβ toxicity and abrogates Aβ-induced impairment of hippocampal long-term potentiation. Cyclic AC253 penetrate blood-brain barrier (BBB) .
|
-
- HY-P4990A
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P4912
-
|
Peptides
|
Others
|
Big Endothelin-1 (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-B1811
-
|
Endogenous Metabolite
|
Neurological Disease
|
Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
|
-
- HY-P1632A
-
|
Bacterial
|
Infection
Cancer
|
Tachyplesin I TFA is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I TFA exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
- HY-P4605
-
-
- HY-P5907
-
|
Opioid Receptor
|
Neurological Disease
|
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain .
|
-
- HY-P10237
-
|
Calcium Channel
|
Others
|
Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and bone resorption in neonatal rat osteoclasts .
|
-
- HY-P3953
-
-
- HY-P1036
-
|
Complement System
|
Others
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-P1574A
-
-
- HY-P5642
-
RC-101
|
Bacterial
|
Infection
|
Retrocyclin-101 is an antimicrobial peptide against of bacterial and viral .
|
-
- HY-P1737
-
Con-S
|
Peptides
|
Cardiovascular Disease
|
Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM .
|
-
- HY-P0004
-
-
- HY-P4990
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P10079
-
-
- HY-P0049
-
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
-
- HY-P4184
-
(Ser4,Ile8)-Oxytocin
|
Peptides
|
Others
|
Isotocin ((Ser4,Ile8)-Oxytocin) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-W539944
-
Arg8-vasopressin acetate; AVP acetate
|
Vasopressin Receptor
Apoptosis
|
Neurological Disease
Cancer
|
Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
|
- HY-P0090A
-
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
- HY-P1463A
-
Thyrocalcitonin eel TFA
|
Thyroid Hormone Receptor
|
Others
|
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis .
|
- HY-P4973
-
|
Peptides
|
Others
|
Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-A0182
-
- HY-P0090
-
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
- HY-P4994
-
- HY-P4605A
-
- HY-P1463
-
Thyrocalcitonin eel
|
Thyroid Hormone Receptor
|
Endocrinology
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
- HY-P2539
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
- HY-P2538
-
- HY-P10383
-
|
NO Synthase
|
Infection
|
SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
- HY-P3512
-
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
Cancer
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
- HY-P0256
-
- HY-P3563
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
[Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
|
- HY-P4191
-
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
- HY-P0207
-
Endothelin-2 (human, canine); Human endothelin-2
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
- HY-P0204
-
- HY-P3448
-
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
- HY-P4191A
-
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
- HY-P0202A
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P3433
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
- HY-17571F
-
Biotin-α-Hypophamine; Biotin-Oxytocic hormone
|
Oxytocin Receptor
|
Others
|
Biotin-Oxytocin (Biotin-α-Hypophamine; Biotin-Oxytocic hormone) is a biological active peptide. (This is Oxytocin (HY-17571) N-terminally labeled with Biotin.)
|
- HY-P5130
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic response in conscious Sprague-Dawley rats. Big endothelin-1 (rat 1-39) raises blood pressure in mice .
|
- HY-P10383A
-
|
NO Synthase
|
Infection
|
SPSB2-iNOS inhibitory cyclic peptide-1 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-1(HY-P10383). SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
- HY-P0256A
-
Apamine TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Apamin TFA (Apamine TFA) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
- HY-P0202
-
- HY-P3571
-
|
Endothelin Receptor
|
Cancer
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
- HY-P10328
-
|
DNA/RNA Synthesis
|
Metabolic Disease
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
- HY-102029
-
SRTX-c
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6c (SRTX-c) is a potent endothelin-B receptor agonist. Sarafotoxin S6c can cause vasoconstriction in both endothelium-intact and endothelium-denuded vessels .
|
- HY-P0204A
-
- HY-P3565
-
STX-b
|
Calcium Channel
|
Cardiovascular Disease
|
Sarafotoxin S6d (STX-b) is a polypeptide toxin isolated from the venom of the Israeli sand boa constrictor. Sarafotoxin S6d induces multiple electrocardiogram (ECG) changes including myocardial ischemia and hyperkalemia. Sarafotoxin S6d induces strong extracellular calcium-dependent vasoconstriction in rat aorta and exhibits positive inotropic effects in rat atria. Sarafotoxin S6d can be used in the study of cardiovascular diseases .
|
- HY-P0207A
-
Endothelin-2 (49-69) (human, canine) TFA; Human endothelin-2 TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
Endothelin-2 (49-69), human (TFA) (Endothelin-2 (49-69) (human, canine) (TFA)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
- HY-P5869
-
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
- HY-P4678
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P3204
-
POT-4
1 Publications Verification
AL-78898A
|
Complement System
|
Metabolic Disease
|
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
|
- HY-P5738
-
|
Bacterial
|
Infection
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
- HY-P0083
-
POR-8
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Ornipressin (POR-8) is a vasopressin agonist specific for the V1 receptor. Ornipressin can be used as a local vasoconstrictor. Ornipressin can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin has antidiuretic activity. Ornipressin decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
- HY-P4678A
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P2315
-
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
- HY-P0083A
-
POR-8 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Ornipressin (POR-8) acetate is a potent vasoconstrictor, hemostatic and renal agent. Ornipressin acetate is a vasopressin agonist specific for the V1 receptor. Ornipressin acetate can be used as a local vasoconstrictor. Ornipressin acetate can reverse the hypotension associated with combine general/epidural anesthesia. Ornipressin acetate has antidiuretic activity. Ornipressin acetate decreases renal vascular resistance and increases renal blood flow in renal failure model .
|
- HY-P2496
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P3071
-
Stichodactyla helianthus neurotoxin
|
Potassium Channel
|
Inflammation/Immunology
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
- HY-P5010
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
- HY-P10924
-
|
Elastase
|
Metabolic Disease
|
Roseltide rT1 is a neutrophil elastase inhibitor (IC50=0.47 μM) rich in cysteine and one of the Roseltide (rT1-rT8) family members. Roseltide rT1 improves cAMP accumulation stimulated by neutrophil elastase in vitro, showing potential for inhibiting related diseases .
|
- HY-P0090S
-
Salmon calcitonin-13C6,15N4 TFA
|
CGRP Receptor
|
Metabolic Disease
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
- HY-17584A
-
|
Guanylate Cyclase
|
Cancer
|
Linaclotide acetate is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation.
|
- HY-P5154
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P10837
-
|
LAG-3
|
Inflammation/Immunology
Cancer
|
LAG-3 cyclic peptide inhibitor 12 (Cyclic peptide 12) is an inhibitor of LAG-3 with an IC50 value of 4.45 μM and a Ki value of 2.66 µM .
|
- HY-P5154A
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P3064
-
Leiurotoxin I
|
Potassium Channel
|
Neurological Disease
|
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo .
|
- HY-P11071
-
|
PCSK9
|
Cardiovascular Disease
|
PCSK9 Inhibitor, EGF-A is a PCSK9 inhibitor. PCSK9 Inhibitor, EGF-A is residues 293-334 of the EGF-A domain of the low-density lipoprotein (LDL) receptor. PCSK9 Inhibitor, EGF-A can prevent PCSK9-induced intracellular LDLR degradation. PCSK9 Inhibitor, EGF-A can be used in the study of hypercholesterolemia and premature atherosclerosis .
|
- HY-161096
-
|
ROR
|
Cancer
|
Antitumor agent-127 (compound 1) is a parent macrocyclic peptide. Antitumor agent-127 displays nanomolar cell-based binding to ROR1 and relatively good internalization in 786-O and MDA-MB-231 tumor cell lines .
|
- HY-P1408A
-
|
Integrin
|
Cancer
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
- HY-P1408
-
|
Integrin
|
Cancer
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
- HY-P5140
-
|
Calcium Channel
|
Metabolic Disease
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
- HY-P5162
-
|
Sodium Channel
|
Inflammation/Immunology
|
Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities .
|
- HY-P5917A
-
Vaejovis mexicanus peptide 24 TFA
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
Vm24-toxin (Vaejovis mexicanus peptide 24) TFA, a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin TFA shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin TFA folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin TFA attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
- HY-P5917
-
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
Vm24-toxin (Vaejovis mexicanus peptide 24), a 36-residue peptide, is a potent and selective Kv1.3 blocker with a Kd of ~3 pM in lymphocytes. Vm24-toxin shows >1500-fold affinity for Kv1.3 over other assayed potassium channels. Vm24-toxin folds into a distorted cystine-stabilized α/β motif consisting of a single-turn α-helix and a three-stranded antiparallel β-sheet, stabilized by four disulfide bridges. Vm24-toxin attenuates the CD4 + effector memory T cell response to T cell receptor (TCR) stimulation .
|
- HY-P5568
-
RP 71955
|
HIV
|
Infection
|
RP 71955 is an antimicrobial peptide against HIV-1 .
|
- HY-P2005
-
|
Reactive Oxygen Species (ROS)
SOD
|
Others
|
Malformin C is an algicidal peptide can be isolated from Aspergillus and exhibits dose-dependent algicidal activity. Malformin C induces a significant increase in ROS levels in algal cells, resulting in impaired SOD activity and high production of MDA content .
|
- HY-P3561A
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P3561
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P1206
-
|
Somatostatin Receptor
|
Neurological Disease
|
CH 275 is a peptide analog of somatostatin and binds preferably to somatostatin receptor 1 (sst1) with a Ki of 52 nM . CH 275 acts as a potent and selective sst1 agonist (IC50=30.9 nM) and also displays IC50 values of 345 nM, >1 μM, >10 μM, >10 μM for human sst3, sst4, sst2 and sst5, respectively . CH 275 can be used for the research of alzheimer’s disease .
|
- HY-P3215A
-
|
Oxytocin Receptor
|
Endocrinology
|
Oxytocin parallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P10698
-
|
Peptide-Drug Conjugates (PDCs)
LDLR
|
Neurological Disease
|
VH-N412 is a vectorized neuropeptide (NT) with good blood-brain barrier permeability. VH-N412 binds to the low-density lipoprotein receptor (LDLR) and neuropeptide receptor 1 (NTSR-1), and acts as a pharmacological-induced hypothermia (PIH) inducer. VH-N412 exhibits anticonvulsant and neuroprotective effects, and can be used in the study of neurological diseases such as epilepsy.
|
- HY-P3215
-
|
Oxytocin Receptor
|
Endocrinology
|
Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P10934
-
LXY2
|
Integrin
|
Cancer
|
LXY3 (LXY2) is a VLA-3-blocking peptide that inhibits the interaction between integrin α3β1 (VLA-3) on neutrophil surfaces and laminin in the basement membrane, thereby preventing neutrophil migration across the tumor vascular basement membrane barrier. LXY3 is used to block neutrophil-mediated nanoparticle release from perivascular pools into the tumor interstitium. LXY3 is commonly employed for targeted imaging of breast cancer .
|
- HY-P1955
-
Velcalcetide; AMG 416; KAI-4169
|
CaSR
|
Metabolic Disease
|
Etelcalcetide (AMG 416; KAI-4169) is a synthetic calcimimetic as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis, which is promising for research in the field of secondary hyperparathyroidism and chronic kidney disease .
|
Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
Cat. No. |
Product Name |
Chemical Structure |
-
- HY-P0090S
-
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
-
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: