MIP-1alpha

By Targets:	CCR (9) Drug Derivative (1) HIV (4) Small Interfering RNA (siRNA) (2)
By Research Areas:	Cancer (4) Endocrinology (2) Infection (4) Inflammation/Immunology (5) Neurological Disease (1)
Oligonucleotides:	Mouse Pre-designed siRNA Sets (1) Human Pre-designed siRNA Sets (1) siRNAs (2)

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P4191A

Met-RANTES (human) acetate	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for *CCR1* and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

HY-19974

TAK-220 2 Publications Verification	CCR HIV	Infection Endocrinology
TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC₅₀s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits *HIV-1, with EC₅₀s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC₉₀s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV*-1 HHA) in PBMCs.

HY-B0498

Bindarit 20+ Cited Publications AF2838	CCR	Neurological Disease Inflammation/Immunology Endocrinology Cancer
Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins *MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1β/CCL4*, MIP-3/CCL23. Bindarit also has anti-inflammatory activity ^[1].

HY-118962

E913	CCR HIV	Infection
E913 is a CCR5 antagonist that competes with the binding of antibodies to CCR5 which recognize the C-terminal half of the second extracellular loop (ECL2B) of CCR5. E913 can specifically block the binding of macrophage inflammatory protein-1alpha (MIP-1alpha) to CCR5 (IC₅₀ = 0.002 μM) and MIP-1alpha-elicited cellular Ca₂₊ mobilization (IC₅₀ = 0.02 μM). E913 inhibits the replication of laboratory and primary R5 *HIV-1* strains as well as various multidrug-resistant monocyte/macrophage tropic (R5) HIV-1 (IC₅₀ = 0.03-0.06 μM). E913 can be used for the research of infection, such as HIV-1 infection ^[1].

HY-P3627

Nagrestipen	Drug Derivative	Cancer
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis ^[1].

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for *CCR1* and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

HY-B0155

Vicriviroc SCH 417690; SCH-D; MK-7690 free base	CCR HIV	Infection Cancer
Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC₅₀ of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC₅₀ values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer ^[1] .

HY-B0155B

Vicriviroc malate SCH 417690 malate; SCH-D malate; MK-7690	CCR HIV	Infection Cancer
Vicriviroc (SCH 417690) malate is an orally active CCR5 antagonist with the IC₅₀ of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC₅₀ values of 0.91 nM and 16 nM,,respectively. Vicriviroc malate can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer ^[1] .

HY-15544

CCR1 antagonist 10	CCR	Inflammation/Immunology
CCR1 antagonist 10 (example 1) is a potent and orally active *CCR1* antagonist. CCR1 antagonist 10 inhibits ¹²⁵I-MIP-1α binding to THP-1 cell membranes with an K_i value of 2.3 nM ^[1].

HY-103360B

trans-J-113863	CCR	Inflammation/Immunology
trans-J-113863 is a potent chemokine *CCR1* and CCR3 receptor antagonist, and inhibits MIP-1α-induced chemotaxis in CCR1 transfectants and eotaxin-induced chemotaxis in CCR3 transfectants with IC₅₀ of 9.57 and 93.8 nM,respectively ^[1] .

HY-RS16642

Ccl3 Mouse Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
Ccl3 Mouse Pre-designed siRNA Set A contains three designed siRNAs for Ccl3 gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

Ccl3 Mouse Pre-designed siRNA Set A Ccl3 Mouse Pre-designed siRNA Set A

HY-RS02099

CCL3 Human Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
CCL3 Human Pre-designed siRNA Set A contains three designed siRNAs for CCL3 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

CCL3 Human Pre-designed siRNA Set A CCL3 Human Pre-designed siRNA Set A

Cat. No.	Product Name	Target	Research Area

HY-P4191A

Met-RANTES (human) acetate	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for *CCR1* and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

HY-P3627

Nagrestipen	Drug Derivative	Cancer
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis ^[1].

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for *CCR1* and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) ^[1].

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-B0498

Bindarit 20+ Cited Publications AF2838	Neurological Disease Classification of Application Fields Ketones, Aldehydes, Acids Source classification Umbelliferae Plants Disease Research Fields Echinacea angustifolia DC. Endocrinology Cancer	CCR
Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins *MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1β/CCL4*, MIP-3/CCL23. Bindarit also has anti-inflammatory activity ^[1].

Species:	Human (2) Rat (1) Mouse (3)
Tag:	His (2) Tag Free (4)
Source:	HEK293 (1) E. coli Cell-free (1) CHO (1) E. coli (3)

Cat. No.	Compare	Product Name	Species	Source

HY-P71898

	MIP-1 alpha/CCL3 Protein, Rat Ccl3; MIP1a; Scya3; C-C motif chemokine 3; Macrophage inflammatory protein 1-alpha; MIP-1-alpha; Small-inducible cytokine A3	Rat	E. coli
	The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

HY-P7768

	MIP-1 alpha/CCL3 Protein, Mouse (His) 1 Publications Verification rMuCCL3, His; C-C motif chemokine 3; Heparin-binding chemotaxis protein; LD78 alpha; MIP-1 alpha; SCYA3; CCL3	Mouse	E. coli
	MIP-1 alpha/CCL3 Protein, Mouse (His), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Mouse (His) is a recombinant mouse CCL3 (A24-A92) expressed by E.coil with a N-6*His tag.

HY-P7254

	MIP-1 alpha/CCL3 Protein, Human (CHO) 1 Publications Verification rHuMIP-1α/CCL3; C-C motif chemokine 3; MIP1A; SCYA3	Human	CHO
	MIP-1 alpha/CCL3 Protein, Human (CHO), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Human (CHO) is a recombinant human CCL3 (A27-A92) expressed by CHO.

HY-P7255

	MIP-1 alpha/CCL3 Protein, Mouse (HEK293) 3 Publications Verification rMuMIP-1α/CCL3; C-C motif chemokine 3; MIP1A; SCYA3	Mouse	HEK293
	MIP-1 alpha/CCL3 Protein, Mouse (HEK293), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Mouse (HEK293) is a recombinant mouse CCL3 expressed by HEK293.

HY-P7256

	MIP-1 alpha/CCL3 Protein, Human rHuMIP-1α/CCL3; C-C motif chemokine 3; MIP1A; SCYA3	Human	E. coli
	MIP-1 alpha/CCL3 Protein, Human, an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Human is a recombinant human CCL3 (S24-A92) expressed by E.coil.

HY-P702232

	CCR1 Protein, Mouse (Cell-Free, His) C-C chemokine receptor type 1; Macrophage inflammatory protein 1-alpha receptor; MIP-1alpha-R; RANTES-R	Mouse	E. coli Cell-free
	CCR1 Protein, a C-C chemokine receptor, binds MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1, initiating signal transduction and elevating intracellular calcium levels. This receptor is crucial in modulating stem cell proliferation, regulating processes vital for tissue homeostasis and immune responses. CCR1's interaction with CREB3 suggests its involvement in complex signaling networks governing cellular functions. CCR1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CCR1 Protein, Mouse (Cell-Free, His) is 355 a.a., with molecular weight of 43.7 kDa.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Compare	Product Name	Application	Reactivity

HY-P86801

	*CCL3/MIP-1 alpha* Antibody (YA6494)** C C motif chemokine 3 antibody; CCL 3 antibody; CCL3 antibody; CCL3_HUMAN antibody; Chemokine (C C motif) ligand 3 antibody; Chemokine C C motif ligand 3 antibody; Chemokine ligand 3 antibody; G0/G1 switch regulatory protein 19 1 antibody; G0/G1 switch regulatory protein 19-1 antibody; G0S19 1 antibody; C C motif chemokine 3 antibody; CCL 3 antibody; CCL3 antibody; CCL3_HUMAN antibody; Chemokine (C C motif) ligand 3 antibody; Chemokine C C motif ligand 3 antibody; Chemokine ligand 3 antibody; G0/G1 switch regulatory protein 19 1 antibody; G0/G1 switch regulatory protein 19-1 antibody; G0S19 1 antibody; G0S19 1 protein antibody; Heparin binding chemotaxis protein antibody; L2G25B antibody; LD78 alpha antibody; LD78-alpha(4-69) antibody; LD78alpha antibody; Macrophage inflammatory protein 1 alpha antibody; Macrophage inflammatory protein 1-alpha antibody; macrophage inflammatory protein 1a antibody; M; IP : 1 alpha antibody; M; IP : 1A antibody; MIP-1-alpha antibody; MIP-1-alpha(4-69) antibody; MIP1 alpha antibody; MIP1A antibody; PAT 464.1 antibody; SCYA 3 antibody; SCYA3 antibody; SIS alpha antibody; SIS beta antibody; SIS-beta antibody; Small inducible cytokine A3 antibody; small inducible cytokine A3 (homologous to mouse MIP-1a) antibody; Small-inducible cytokine A3 antibody; Tonsillar lymphocyte LD78 alpha protein antibody;	WB, ICC/IF, IHC-P	Human, Mouse
	CCL3/MIP-1 alpha Antibody (YA6494) is a Rabbit-derived and non-conjugated IgG monoclonal antibody, targeting to CCL3/MIP-1 alpha.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Host
Reactivity
Application
Dilution Ratio
Molecular Weight
Conjugation
Clonality
Immunogen
Appearance
Isotype
Gene ID
SwissProt ID
Purity
Formulation
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Product Name		Classification

HY-RS16642

Ccl3 Mouse Pre-designed siRNA Set A		siRNAs Mouse Pre-designed siRNA Sets
Ccl3 Mouse Pre-designed siRNA Set A contains three designed siRNAs for Ccl3 gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

HY-RS02099

CCL3 Human Pre-designed siRNA Set A		siRNAs Human Pre-designed siRNA Sets
CCL3 Human Pre-designed siRNA Set A contains three designed siRNAs for CCL3 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社重松貿易株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inhibitors & Agonists

Peptides

Natural
Products

Recombinant Proteins

Antibodies

Oligonucleotides

Name
Email *

	Sorry, but the email address you supplied was invalid.

MIP-1alpha

Inhibitors & Agonists

Peptides

NaturalProducts

Recombinant Proteins

Antibodies

Oligonucleotides

Natural
Products