1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Chemokine & Receptors G-Protein-Coupled Receptors (GPCRs)
  4. CC Chemokine Receptor Chemokine Receptor
  5. CCR1
  6. CCR1 Protein, Mouse (Cell-Free, His)

CCR1 Protein, a C-C chemokine receptor, binds MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1, initiating signal transduction and elevating intracellular calcium levels. This receptor is crucial in modulating stem cell proliferation, regulating processes vital for tissue homeostasis and immune responses. CCR1's interaction with CREB3 suggests its involvement in complex signaling networks governing cellular functions. CCR1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CCR1 Protein, Mouse (Cell-Free, His) is 355 a.a., with molecular weight of 43.7 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCR1 Protein, a C-C chemokine receptor, binds MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1, initiating signal transduction and elevating intracellular calcium levels. This receptor is crucial in modulating stem cell proliferation, regulating processes vital for tissue homeostasis and immune responses. CCR1's interaction with CREB3 suggests its involvement in complex signaling networks governing cellular functions. CCR1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CCR1 Protein, Mouse (Cell-Free, His) is 355 a.a., with molecular weight of 43.7 kDa.

Background

CCR1, a receptor belonging to the C-C type chemokine family, serves as a binding site for chemokines such as MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1. Upon ligand binding, CCR1 initiates signal transduction processes that lead to an elevation in intracellular calcium ion levels. This receptor plays a pivotal role in modulating stem cell proliferation, contributing to the regulation of cellular processes critical for tissue homeostasis and immune responses. Additionally, CCR1 interacts with CREB3, potentially participating in the intricate network of signaling pathways that govern cellular functions.

Species

Mouse

Source

E. coli Cell-free

Tag

N-10*His

Accession

P51675 (M1-F355)

Gene ID

12768

Molecular Construction
N-term
10*His
CCR1 (M1-F355)
Accession # P51675
C-term
Synonyms
C-C chemokine receptor type 1; Macrophage inflammatory protein 1-alpha receptor; MIP-1alpha-R; RANTES-R
AA Sequence

MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF

Molecular Weight

43.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCR1 Protein, Mouse (Cell-Free, His)
Cat. No.:
HY-P702232
Quantity:
MCE Japan Authorized Agent: