1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. M-CSF
  5. M-CSF Protein, Human (CHO)

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis. M-CSF Protein, Human (CHO) is a recombinant human M-CSF protein expressed in CHO cells with tag-free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis[1][2][3][4]. M-CSF Protein, Human (CHO) is a recombinant human M-CSF protein expressed in CHO cells with tag-free.

Background

1. M-CSF Protein Protein Characteristics[1][2][3]
M-CSF, or macrophage colony stimulating factor, CSF-1, is a disulfide-linked homodimer belonging to the colony stimulating factor (CSF) family. M-CSF is a hematopoietic growth factor and proinflammatory cytokine with multiple glycosylation sites, belonging to the hematopoietic growth factor family along with GM-CSF and G-CSF. M-CSF affects the survival and function of tissue macrophages and has anti-tumor activity[1]. M-CSF is expressed in a variety of cells, such as fibroblasts, endothelial cells, stromal cells, macrophages, smooth muscle cells and osteoblasts, and has multiple subtypes. M-CSF can be a secreted glycoprotein, a cell surface protein and a proteoglycan, binding to its receptor CSF1R[2]. M-CSF can specifically act on the monocyte-macrophage lineage, participate in the development and proliferation of monocyte/macrophage lineage cells, and participate in the induction of osteoclasts. Osteoclasts are very important for the destruction of bone and cartilage and the changes in periarticular osteoporosis in patients with rheumatoid arthritis[3].
2. M-CSF Protein Functional Characteristics[1][4]
M-CSF is regulated by LPS and IFN-γ upstream, and regulates inflammatory factors such as IL-12 and TNF-α downstream. M-CSF induces macrophage polarization to M1 type, and enhances antibody-dependent cellular cytotoxicity (ADCC) by upregulating surface molecules such as CD80 and CD16, exerting anti-tumor effects. M-CSF may induce macrophage polarization to M2 type, promoting VEGF secretion and angiogenesis.
3. Application of M-CSF Protein[1][4][5][6]
Oncology: Clinical trials have shown that M-CSF combined with monoclonal antibodies can enhance tumor-targeted killing, but its pro-angiogenic effect may promote metastasis.
Infection and Immunity: Enhance the antifungal (such as Candida) and anti-tuberculosis activity of macrophages, and use it to treat infections in immunocompromised patients.
Hematopoietic Repair: Restore monocyte counts after chemotherapy/transplantation and shorten the neutrophil deficiency period.
Bone Disease: Regulate osteoclasts, used in osteoporosis and rheumatoid arthritis research.

Biological Activity

The ED50 is <5 ng/mL as measured by Murine M-NFS-60 cells, corresponding to a specific activity of >2 × 105 units/mg.

  • Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.9606 ng/mL, corresponding to a specific activity is 1.041×106 U/mg.
Species

Human

Source

CHO

Tag

Tag Free

Accession

P09603-3 (E33-S190)

Gene ID
Molecular Construction
N-term
M-CSF (E33-S190)
Accession # P09603-3
C-term
Protein Length

Partial

Synonyms
rHuM-CSF; CSF-1; MGI-IM
AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Molecular Weight

Approximately 18-22 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

M-CSF Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
M-CSF Protein, Human (CHO)
Cat. No.:
HY-P7050A
Quantity:
MCE Japan Authorized Agent: