1. Recombinant Proteins
  2. CD Antigens
  3. Stem Cell CD Proteins Erythrocyte CD Proteins
  4. Glycophorin-A/CD235a
  5. GYPA/CD235a Protein, Human (His)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV). GYPA/CD235a Protein, Human (His) is the recombinant human-derived GYPA/CD235a protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV). GYPA/CD235a Protein, Human (His) is the recombinant human-derived GYPA/CD235a protein, expressed by E. coli , with N-6*His labeled tag.

Background

GYPA, also known as Glycophorin A, serves as a pivotal component within the ankyrin-1 complex, a multiprotein assembly crucial for maintaining the stability and shape of the erythrocyte membrane. As the major intrinsic membrane protein of erythrocytes, GYPA contributes significantly to membrane integrity. Its N-terminal glycosylated segment, projecting beyond the erythrocyte membrane, bears MN blood group receptors and plays a vital role in erythrocyte function. GYPA is particularly essential for the optimal activity of SLC4A1, and its presence is required for the high activity of this membrane transporter. Moreover, GYPA is implicated in the translocation of SLC4A1 to the plasma membrane. Beyond its structural role, GYPA acts as a receptor for influenza virus, Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175), and Hepatitis A virus (HAV), highlighting its diverse functional repertoire. Existing as a homodimer, GYPA is an integral part of the ankyrin-1 complex, collaborating with other proteins such as ANK1, RHCE, RHAG, SLC4A1, EPB42, GYPB, and AQP1 in the erythrocyte membrane, thereby contributing to the overall structural integrity and functionality of these blood cells. The interaction with SLC4A1 results in the formation of a heterotetramer, emphasizing the cooperative nature of the erythrocyte membrane complex[1][2][3].

Biological Activity

Immobilized GYPA at 2μg/mL (100μL/well) can bind GYPA Antibody. The ED50 for this effect is 1.443 μg/mL.

  • Immobilized GYPA at 2 μg/mL (100 μL/well) can bind GYPA Antibody. The ED50 for this effect is 1.443 μg/mL.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

A0A0C4DFT7 (L20-E91)

Gene ID
Molecular Construction
N-term
6*His
GYPA (L20-E91)
Accession # A0A0C4DFT7
C-term
Protein Length

Extracellular Domain

Synonyms
Glycophorin-A; GYPA
AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Weight

Approximately 11 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm solution of Tris-based buffer, 50% Glycerol or 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GYPA/CD235a Protein, Human (His)
Cat. No.:
HY-P72219
Quantity:
MCE Japan Authorized Agent: