Galectin-8/LGALS8 Protein, Human (GST)

Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human (GST) is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with N-GST labeled tag.

Galectin-8 (Gal-8), encoded by LGALS8 gene, is a unique member of the Galectin family with diverse biological functions, including tumor-modulating capabilities. Galectin-8 is involved in regulating innate and adaptive immunity, and is highly expressed in tumors and other immune disorders. Galectin-8 as a functional ligand of LILRB, which induced MDSC expansion and promoted tumor progression in vivo. Galectin-8, encoded by the LGALS8 gene, is a member of mammalian lectins with unique features, which emerged as an immune regulator of both innate and adaptive immunity^[1].

Human

E. coli

N-GST

O00214-1 (M1-W317)

3964  [NCBI]

Full Length of Isoform-1

MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Wang Y, et al. Galectin-8 alters immune microenvironment and promotes tumor progression. Am J Cancer Res. 2023 Jun 15;13(6):2517-2529.  [Content Brief]