1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A1
  6. Ephrin-A1/EFNA1 Protein, Human (HEK293, Fc)

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand that interacts with Eph receptors and is critical for migration and adhesion. It recruits VAV2, VAV3, and PI3 kinase p85 subunits through EPHA2 phosphorylation, activating RAC1 GTPase for endothelial cell migration. Ephrin-A1/EFNA1 Protein, Human (HEK293, Fc) is the recombinant human-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Ephrin-A1/EFNA1 Protein, Human (HEK293, Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand that interacts with Eph receptors and is critical for migration and adhesion. It recruits VAV2, VAV3, and PI3 kinase p85 subunits through EPHA2 phosphorylation, activating RAC1 GTPase for endothelial cell migration. Ephrin-A1/EFNA1 Protein, Human (HEK293, Fc) is the recombinant human-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Ephrin-A1/EFNA1 Protein is a cell surface GPI-bound ligand that interacts with Eph receptors, a family of receptor tyrosine kinases crucial for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. It binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling. Ephrin-A1/EFNA1 Protein plays a significant role in angiogenesis and tumor neovascularization by recruiting VAV2, VAV3, and PI3-kinase p85 subunit through phosphorylated EPHA2, leading to RAC1 GTPase activation and vascular endothelial cell migration and assembly. Moreover, it exhibits anti-oncogenic effects in tumor cells by activating and down-regulating EPHA2 through tyrosine phosphorylation, resulting in its internalization and degradation. Furthermore, Ephrin-A1/EFNA1 Protein acts as a negative regulator in glioma tumorigenesis by down-regulating EPHA2 and FAK. It can induce the collapse of embryonic neuronal growth cones and regulate dendritic spine morphogenesis. Ephrin-A1/EFNA1 Protein exists as a monomer and homodimer, and it forms heterodimers with EPHA2. It binds to several receptor tyrosine kinases including EPHA1, EPHA2, EPHA3, EPHA4, EPHA5, EPHA6, and EPHA7, albeit with low affinity.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Ephrin-A1 (HY-P72662) is immobilized at 2 µg/mL (100 µL/well) can bind Human EphA1 (HY-P70321). The ED50 for this effect is 17.1 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Ephrin-A1 (HY-P72662) is immobilized at 2 µg/mL (100 µL/well) can bind Human EphA1 (HY-P70321). The ED50 for this effect is 17.1 ng/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P20827-1 (D19-S182)

Gene ID
Molecular Construction
N-term
EFNA1 (D19-S182)
Accession # P20827-1
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Ephrin-A1; LERK-1; EFNA1; EPLG1; TNFAIP4
AA Sequence

DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS

Molecular Weight

Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-A1/EFNA1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A1/EFNA1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72662
Quantity:
MCE Japan Authorized Agent: