1. Search Result
Search Result
Results for "

destruction

" in MedChemExpress (MCE) Product Catalog:

61

Inhibitors & Agonists

4

Screening Libraries

1

Fluorescent Dye

2

Biochemical Assay Reagents

12

Peptides

6

Inhibitory Antibodies

6

Natural
Products

3

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-N9794

    Others Inflammation/Immunology
    Isoboldine is a pyridine alkaloid. Isoboldine effectively alleviates inflammation and joint destruction in collagen-induced arthritis in mice .
    Isoboldine
  • HY-76701

    Drug Derivative Cancer
    4-Nitrothalidomide is a nitrosylated Thalidomide analogue. Thalidomide is a ligand for E3 ligase, which ubiquitinylates proteins, thus committing their fate to proteolytic destruction.
    4-Nitrothalidomide
  • HY-19364
    Ferroquine
    1 Publications Verification

    Ferrochloroquine; SSR97193

    Parasite Infection
    Ferroquine (Ferrochloroquine), a ferrocenyl analogue of Chloroquine, is an antimalarial agent. Ferroquine shows parasiticidal effect on Plasmodium by inducing oxidative stress and the subsequent destruction of the membrane .
    Ferroquine
  • HY-17644

    LUZ11; F2BMet

    Reactive Oxygen Species (ROS) Cancer
    Redaporfin (LUZ11) acts as a potent photosensitizer. Redaporfin causes direct antineoplastic effects as well as indirect immune-dependent destruction of malignant lesions .
    Redaporfin
  • HY-128380

    N-​(2-​Chloroethyl)​dibenzylamine hydrochloride

    Adrenergic Receptor Metabolic Disease
    Dibenamine hydrochloride is a competitive and irreversible adrenergic blocking agent and is known to modify the pharmacological effects of epinephrine. Dibenamine hydrochloride cause a significant increase in the rate of destruction of I-epinephrine in the mouse .
    Dibenamine hydrochloride
  • HY-108004

    Septefril; Decametoxin

    Bacterial Fungal Infection
    Decamethoxine (Septefril) is a cationic gemini surfactant. Decamethoxine exhibits strong bactericidal and fungicidal effects. Decamethoxine modifies the permeability of the microbial cell membrane, resulting in the destruction and death of diverse microorganisms .
    Decamethoxine
  • HY-114996
    ADAMTS-5 Inhibitor
    4 Publications Verification

    ADAMTS Inflammation/Immunology
    ADAMTS-5 Inhibitor is a potent ADAMTS-5 (aggrecanase-2) inhibitor, with an IC50 of 1.1 µM. ADAMTS-5 Inhibitor shows >40-fold functional selectivity over ADAMTS-4 (aggrecanase-1) .
    ADAMTS-5 Inhibitor
  • HY-156996

    Others Inflammation/Immunology Cancer
    AGI-134 is a fully synthetic alpha-Gal glycolipid. AGI-134 invokes CD8+ T cell-mediated immunity. AGI-134 induces tumor cell destruction and phagocytosis .
    AGI-134
  • HY-W867704

    Ligands for E3 Ligase Cancer
    4-Me-Thalidomide is an E3 ligase activator featuring a methyl group. E3 ligase is a protein that marks other proteins for proteolytic destruction by labeling them with ubiquitin.
    4-Me-Thalidomide
  • HY-N12740

    MEK ERK Others
    Napyradiomycin B4 is a Napyradiomycin derivative, which inhibits the RANKL-induced MEK-ERK signaling pathway. Napyradiomycin B4 attenuates osteoclastogenesis and prevents alveolar bone destruction in experimental periodontitis .
    Napyradiomycin B4
  • HY-P0009

    SB-75

    GnRH Receptor Endocrinology
    Cetrorelix is a potent gonadotrophin-releasing hormone (GnRH) antagonist. Cetrorelix inhibits the endogenous luteinizing hormone surge during ovarian stimulation. Cetrorelix reduces cyclophosphamide induced ovarian follicular destruction in mice .
    Cetrorelix
  • HY-W441376

    Ligands for E3 Ligase Cancer
    Thalidomide-1-Me,4-OH is a Thalidomide analogue featuring an alcohol. Thalidomide is a ligand for E3 ligase, which ubiquitinylates proteins, thus committing their fate to proteolytic destruction.
    Thalidomide-1-Me,4-OH
  • HY-128075

    Herbicide Cancer
    Acifluorfen, a protoporphyrinogen oxidase (PROTOX) inhibitor herbicide, promotes the accumulation of protoporphyrin IX (PPIX), and induces tumors in the rodent liver. Acifluorfen causes strong photooxidative destruction of pigments and lipids in sensitive plant species .
    Acifluorfen
  • HY-118985

    Endogenous Metabolite Cancer
    Acifluorfen sodium, a protoporphyrinogen oxidase (PROTOX) inhibitor herbicide, promotes the accumulation of protoporphyrin IX (PPIX), and induces tumors in the rodent liver. Acifluorfen sodium causes strong photooxidative destruction of pigments and lipids in sensitive plant species .
    Acifluorfen sodium
  • HY-W674381

    Ligands for E3 Ligase Cancer
    5-(2-Chloroacetamide) thalidomide is a Thalidomide (HY-14658) analogue. Thalidomide recruits E3 Ligase for the ubiquitinylation and subsequent destruction of a given protein. This structure features a chloroacetamide, which is a thiol-specific reactive group.
    5-(2-Chloroacetamide) thalidomide
  • HY-P99105

    CAEL-101

    Apolipoprotein Amyloid-β Neurological Disease
    Anselamimab (CAEL-101) is a chimeric monoclonal antibody for systemic light chain (AL) amyloidosis. Anselamimab can promote phagocytic destruction and subsequent clearance of amyloid deposits. Anselamimab can be used in the research of amyloidosis .
    Anselamimab
  • HY-W244282

    Ligands for E3 Ligase Cancer
    Thalidomide-pinacolborane is a Thalidomide analogue featuring a boronic pinacol ester, otherwise known as a Bpin group, and they are most frequently used in Suzuki reactions. This molecule is an activator for E3 ligase, which ubiquitinylates proteins, thus committing their fate to proteolytic destruction.
    Thalidomide-pinacolborane
  • HY-106431

    Olpadronate; OLP

    Others Metabolic Disease Cancer
    Olpadronic acid (Olpadronate) is an orally active amino-bisphosphonate and inhibits bone resorption. Olpadronic acid also prevents bone destruction and tumor growth in the skeletal prostate cancer mouse model. Olpadronic acid can be used for research of osteoporosis, malignancies and rheumatoid arthritis .
    Olpadronic acid
  • HY-W458018

    Ligands for E3 Ligase Cancer
    Thalidomide-4-Br,7-F is an E3 ligase activator featuring a bromine and a fluorine. E3 ligase is a protein that marks other proteins for proteolytic destruction by labeling them with ubiquitin. Both halogens may be substituted for further derivitization.
    Thalidomide-4-Br,7-F
  • HY-123606

    Protein Arginine Deiminase Inflammation/Immunology
    GSK484 is a PAD4 inhibitor. GSK484 reduces inflammation and joint destruction in CIA mouse models. GSK484 inhibits TNF-α expression and reverses Erastin-induced gut dysbiosis. GSK484 can be used in rheumatoid arthritis (RA) research .
    GSK484
  • HY-24574

    (E)-Octadec-5-ene

    Others Endocrinology
    (E)-5-Octadecene ((E)-Octadec-5-ene) is a sex pheromone or a related chemical component. (E)-5-Octadecene has effect on destruction of sexual attraction of female moth of rice borers moth (Chilo suppressalis Walker) .
    (E)-5-Octadecene
  • HY-131890

    DNA Alkylator/Crosslinker E3 Ligase Ligand-Linker Conjugates Cancer
    VH032 amide-PEG1-acid (linker 10) is a VHL-1 alkyl linker that can be used to bind CDK4/6 ligands (PI) and degradation/destruction tags (EL) (e.g.,E3 ligase ligands) .
    VH032 amide-PEG1-acid
  • HY-105063

    HSP Metabolic Disease Inflammation/Immunology
    DiaPep277 is a 24 amino acid peptide derived from positions 437-460 in HSP60. DiaPep277 arrests the progression of β-cell destruction in NOD mice. DiaPep277 has an immune modulatory effect on diabetogenic T cells in animal models of diabetes .
    DiaPep277
  • HY-136990

    Others Cancer
    GLPG0259 is a ATP-competitive inhibitor of MAPK-activated protein kinase 5 (MK5) with oral activity. GLPG0259 reduces inflammation and bone destruction in a mouse model of collagen-induced arthritis. GLPG0259 also inhibited the metastasis of prostate cancer (PCa) cells .
    GLPG0259
  • HY-N0070
    Solasonine
    2 Publications Verification

    Ferroptosis Glutathione Peroxidase Reactive Oxygen Species (ROS) Cancer
    Solasonine is a ferroptosis inducer which can be isolated from Solanum melongena that has anti-infection, anti-cancer, and neurogenesis promoting properties. Solasonine promotes ferroptosis of HCC cells via destruction of the glutathione redox system induced by inhibiting GPX4, and can be used for cancer research .
    Solasonine
  • HY-128075R

    Herbicide Reference Standards Cancer
    Acifluorfen (Standard) is the analytical standard of Acifluorfen. This product is intended for research and analytical applications. Acifluorfen, a protoporphyrinogen oxidase (PROTOX) inhibitor herbicide, promotes the accumulation of protoporphyrin IX (PPIX), and induces tumors in the rodent liver. Acifluorfen causes strong photooxidative destruction of pigments and lipids in sensitive plant species .
    Acifluorfen (Standard)
  • HY-W990229

    PROTAC Linkers Cancer
    Thalidomide-O-PEG1-OH is a PROTAC linker featuring thalidomide with an O-ethyl alcohol. Thalidomide is a ligand for E3 ligase, which ubiquitinylates proteins, thus committing their fate to proteolytic destruction. Meanwhile, the hydroxyl is a versatile handle for forming more complex structures through a number of reactions.
    Thalidomide-O-PEG1-OH
  • HY-154996

    Fungal γ-Glutamyl Transferase (GGT) Infection
    Gamma-Glutamyl Transferase-IN-2 (compound 4dq) is a β-carboline 1-hydrazide inhibitor with antifungal and antibacterial activities, targeting to glutamyltransferase. Gamma-Glutamyl Transferase-IN-2 acts function by resulting the accumulation of reactive oxygen species, destruction of cell membranes, and dysregulation of histone acetylation .
    Gamma-Glutamyl Transferase-IN-2
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-P0009S1

    SB-75-d10

    Isotope-Labeled Compounds GnRH Receptor Endocrinology
    Cetrorelix-d10 (SB-75-d10) is deuterium labeled Cetrorelix. Cetrorelix is a potent gonadotrophin-releasing hormone (GnRH) antagonist. Cetrorelix inhibits the endogenous luteinizing hormone surge during ovarian stimulation. Cetrorelix reduces cyclophosphamide induced ovarian follicular destruction in mice .
    Cetrorelix-d10
  • HY-Z8648

    Drug Intermediate Inflammation/Immunology Endocrinology Cancer
    Δ14-Triamcinolone acetonide is a potential impurity. Triamcinolone acetonide inhibits basic fibroblast growth factor (bFGF) induced proliferation of retinal endothelial cells. Triamcinolone acetonide reduces chondrocyte viability and leads to cartilage destruction. Triamcinolone acetonide can be used in the study of diseases such as atopic dermatitis .
    Δ14-Triamcinolone acetonide
  • HY-B0636
    Triamcinolone acetonide
    5+ Cited Publications

    Glucocorticoid Receptor FGFR Cardiovascular Disease Inflammation/Immunology Endocrinology Cancer
    Triamcinolone acetonide inhibits basic fibroblast growth factor (bFGF) induced proliferation of retinal endothelial cells. Triamcinolone acetonide reduces chondrocyte viability and leads to cartilage destruction. Triamcinolone acetonide activates macrophage with anti-inflammatory characteristics. Triamcinolone acetonide can be used in the study of diseases such as atopic dermatitis .
    Triamcinolone acetonide
  • HY-106431R

    Olpadronate (Standard); OLP (Standard)

    Reference Standards Others Metabolic Disease Cancer
    Olpadronic acid (Standard) is the analytical standard of Olpadronic acid. This product is intended for research and analytical applications. Olpadronic acid (Olpadronate) is an orally active amino-bisphosphonate and inhibits bone resorption. Olpadronic acid also prevents bone destruction and tumor growth in the skeletal prostate cancer mouse model. Olpadronic acid can be used for research of osteoporosis, malignancies and rheumatoid arthritis .
    Olpadronic acid (Standard)
  • HY-154993

    Fungal γ-Glutamyl Transferase (GGT) Infection
    Gamma-Glutamyl Transferase-IN-1 (compound 4de) is a β-carboline 1-hydrazide inhibitor with antifungal and antibacterial activities, targeting to glutamyltransferase. Gamma-Glutamyl Transferase-IN-1 acts function by resulting the accumulation of reactive oxygen species, destruction of cell membranes, and dysregulation of histone acetylation .
    Gamma-Glutamyl Transferase-IN-1
  • HY-174156

    RANKL/RANK TNF Receptor Inflammation/Immunology
    Y2641, a etrahydro-β-carboline derivative, is an orally active dual RANKL/TNF-α inhibitor with Kd values of 3.984 μM and 18.59 μM for RANKL and TNF-α, respectively. Y2641 inhibits RANKL-induced osteoclastogenic and has anti-inflammatory and cartilage destruction. Y2641 can be used for study of osteoarthritis .
    Y2641
  • HY-W127809

    Biochemical Assay Reagents Others
    Chlorin e4 is an organic compound belonging to the family of chlorins, which are macrocyclic compounds with a similar structure to porphyrins. It is commonly used to improve photodynamic therapy for cancer and other diseases. Chlorin e4 has multiple applications in medical research, including as a photosensitizer for localized tumor destruction. In addition, its antimicrobial properties and potential use in disinfection applications were investigated.
    Chlorin e4
  • HY-N0070R

    Reference Standards Ferroptosis Glutathione Peroxidase Reactive Oxygen Species (ROS) Cancer
    Solasonine (Standard) is the analytical standard of Solasonine. This product is intended for research and analytical applications. Solasonine is a ferroptosis inducer which can be isolated from Solanum melongena that has anti-infection, anti-cancer, and neurogenesis promoting properties. Solasonine promotes ferroptosis of HCC cells via destruction of the glutathione redox system induced by inhibiting GPX4, and can be used for cancer research .
    Solasonine (Standard)
  • HY-P2612A

    TNF Receptor Others Cancer
    WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
    WP9QY TFA
  • HY-146421

    NO Synthase NF-κB Reactive Oxygen Species (ROS) Inflammation/Immunology
    Anti-inflammatory agent 21 (compound 9o) is an orally active and low cytotoxic anti-inflammatory agent, with an IC50 value of 0.76 μM for NO. Anti-inflammatory agent 21 acts via accumulation ROS and blocks the NF-κB/MAPK signaling pathway. Anti-inflammatory agent 21 can ameliorate cartilage destruction and inflammatory cell infiltration in arthritis rats model .
    Anti-inflammatory agent 21
  • HY-N6973R
    Boldine (Standard)
    1 Publications Verification

    Reference Standards RANKL/RANK Inflammation/Immunology
    Boldine (Standard) is the analytical standard of Boldine. This product is intended for research and analytical applications. Boldine is an aporphine isoquinoline alkaloid extracted from the root of Litsea cubeba and also possesses these properties, including antioxidant, anti-inflammatory and cytoprotective effects. Boldine suppresses osteoclastogenesis, improves bone destruction by down-regulating the OPG/RANKL/RANK signal pathway and may be a potential therapeutic agent for rheumatoid arthritis .
    Boldine (Standard)
  • HY-P2612

    TNF Receptor Others
    WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
    WP9QY
  • HY-P10438

    Raf Cancer
    TAT-Braftide is a peptide inhibitor designed to block the dimerization of BRAF, thereby inhibiting its kinase activity. The destruction of BRAF dimer by TAT-Braftide makes BRAF protein more susceptible to proteasome degradation, directly inhibits the activity of BRAF kinase, and reduces the activation of MAPK signaling pathway. Tat-braftide can be used for the role of RAF kinase in MAPK signaling pathway and for the study of BRAF mutant cancers .
    TAT-Braftide
  • HY-P99259

    FPA 008; Anti-Human CSF1R Recombinant Antibody

    c-Fms Inflammation/Immunology Cancer
    Cabiralizumab (FPA 008) is an anti-CSF1R monoclonal antibody (MAb). Cabiralizumab enhances T cell infiltration and antitumor T cell immune responses. Cabiralizumab inhibits the activation of osteoclasts and blocks bone destruction, and can be used in the research of rheumatoid arthritis (RA). Cabiralizumab can combine with Nivolumab (HY-P9903) for lung cancer research .
    Cabiralizumab
  • HY-P4191A

    CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-P10743

    Radionuclide-Drug Conjugates (RDCs) PSMA Cancer
    BQ7876 is a probe targeting prostate-specific membrane antigen (PSMA) that contains a DOTA chelator. BQ7876, after being radiolabeled with radionuclide (177Lu), functions in both radionuclide imaging and tumor cell destruction by specifically binding to PSMA. BQ7876 shows potential for research in the field of metastatic castration-resistant prostate cancer (mCRPC) . BQ7876 can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
    BQ7876
  • HY-P99625

    SAR441344; INX-021

    TNF Receptor Metabolic Disease Inflammation/Immunology
    Frexalimab (SAR441344) is a second-generation monoclonal antibody targeting the CD40 ligand (CD40L) with a good safety profile. Frexalimab inhibits the binding between CD40 and CD40L to modulate immune response. Frexalimab is likely to help prevent the process of β-cell destruction. Frexalimab is proming for multiple sclerosis, lupus erythematosus, Sj gren’s syndrome and type I diabetes research .
    Frexalimab
  • HY-P10370

    Bacterial Apoptosis Infection Cancer
    d-(KLAKLAK)2, as an antibacterial and anti-tumor polypeptide, is a representative of the antimicrobial peptide group, and also has good anticancer properties. d-(KLAKLAK)2 is able to kill bacteria by damaging their cell membranes, causing cell contents to leak out. d-(KLAKLAK)2 can also inhibit tumor cell proliferation by causing mitochondrial swelling and mitochondrial membrane destruction, triggering apoptosis (programmed cell death) .
    d-(KLAKLAK)2, Proapoptotic Peptide
  • HY-B0636S1

    Isotope-Labeled Compounds Glucocorticoid Receptor FGFR Cardiovascular Disease Inflammation/Immunology Endocrinology Cancer
    Triamcinolone acetonide- 13C3 is the 13C-labeled Triamcinolone acetonide (HY-B0636). Triamcinolone acetonide inhibits basic fibroblast growth factor (bFGF) induced proliferation of retinal endothelial cells. Triamcinolone acetonide reduces chondrocyte viability and leads to cartilage destruction. Triamcinolone acetonide activates macrophage with anti-inflammatory characteristics. Triamcinolone acetonide can be used in the study of diseases such as atopic dermatitis .
    Triamcinolone acetonide-13C3
  • HY-105048A

    Bacterial Infection
    Omiganan pentahydrochloride is a cationic peptide compound with a broad antibacterial profile. Omiganan pentahydrochloride is capable of inhibiting a variety of bacteria, including yeast, and is active against both gram-positive and gram-negative bacteria. Omiganan pentahydrochloride is able to interact with the bacterial cell membrane, causing the destruction of the cell membrane and the death of the bacteria. Omiganan pentahydrochloride can be used for the study of antimicrobial activity against pathogens commonly associated with catheter-associated infections, including strains with drug-resistant phenotypes .
    Omiganan pentahydrochloride
  • HY-10408
    Ki20227
    5 Publications Verification

    c-Fms VEGFR c-Kit PDGFR Inflammation/Immunology
    Ki20227 is an orally active and highly selective c-Fms tyrosine kinase (CSF1R) inhibitor with IC50s of 2 nM, 12 nM, 451 and 217 nM for CSF1R, VEGFR2 (vascular endothelial growth factor receptor-2), c-Kit (stem cell factor receptor) and PDGFRβ (platelet-derived growth factor receptor β). Ki20227 suppresses osteoclast differentiation and osteolytic bone destruction .
    Ki20227

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: