1. Search Result
Search Result
Results for "

cathelicidin

" in MedChemExpress (MCE) Product Catalog:

18

Inhibitors & Agonists

18

Peptides

1

Recombinant Proteins

2

Antibodies

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-P1884

    Bacterial Infection
    LL-37, acetylated, amidated is a cathelicidin peptide LL-37 acetylated on the N-terminus and amidated on the C-terminus. The single human cathelicidin peptide LL-37 has antimicrobial and anti-biofilm activity against multiple Gram-positive and Gram-negative human pathogens, and has wound-healing effects on the host .
    LL-37, acetylated,amidated
  • HY-P1513A

    Bacterial Infection
    LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.
    LL-37 scrambled peptide acetate
  • HY-P2460

    Bacterial Fungal Infection Inflammation/Immunology
    SMAP-29, a promising antiinfective agent, is a broad spectrum antibacterial and antifungal α-helical cathelicidin-derived peptide. SMAP-29 acts by permeabilizing bacterial membranes and inducing remarkable changes in the surface morphology of susceptible microorganism .
    SMAP-29
  • HY-P10160

    chCATH-2

    Bacterial Infection
    Cathelicidin-2 chicken is antimicrobial peptide. Cathelicidin-2 chicken shows potent bactericidal and fungicidal activity against chicken-specific salmonella isolates .
    Cathelicidin-2 (chicken)
  • HY-P4071

    cathelicidin-OH antimicrobial peptide

    Bacterial Infection
    OH-CATH is a natural antimicrobial peptide that can be isolated from the venom and tissue of Ophiophagus hannah (King Cobra) .
    OH-CATH
  • HY-P10431

    Sea snake cathelicidin

    Bacterial Infection Inflammation/Immunology
    Hc-CATH (Sea snake cathelicidin) is an antibacterial peptide with broad-spectrum. Hc-CATH inhibits Shigella dysenteriae and Klebsiella pneumoniae with MIC of 0.16 mM-20.67 mM. Hc-CATH exhibits anti-inflammatory efficacy .
    Hc-CATH
  • HY-P10158

    Porcine cathelicidin PMAP-36

    Bacterial Infection
    PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
    PMAP-36
  • HY-P2457

    Bacterial Infection Inflammation/Immunology
    rCRAMP (rat) is the rat cathelin-related antimicrobial peptide. rCRAMP (rat) contributes to the antibacterial activity in rat brain peptide/protein extracts. rCRAMP (rat) is a potential key player in the innate immune system of rat CNS .
    rCRAMP (rat)
  • HY-P10345

    Bacterial Infection
    OP-145, an cathelicidin LL-37 derivative, is an antimicrobial peptide, and shows antibacterial activity against several MRSA strains. OP-145 can be used for research of chronic suppurative otitis media .
    OP-145
  • HY-P1513

    Bacterial Infection
    LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.
    LL-37 scrambled peptide
  • HY-P1222
    LL-37, human
    3 Publications Verification

    Bacterial Infection
    LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing .
    LL-37, human
  • HY-P1222B
    LL-37, human acetate
    3 Publications Verification

    Bacterial Infection Inflammation/Immunology
    LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing .
    LL-37, human acetate
  • HY-P1222A
    LL-37, human TFA
    3 Publications Verification

    Bacterial Infection
    LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing .
    LL-37, human TFA
  • HY-P5486

    Bacterial Others
    Tet-20 is a biological active peptide. (Tet-20, is a synthetic cathelicidin-derived peptide. It was tested as infection-resistant coating for medical devices. When tethered on an implant surface Tet-20 exhibited broad antimicrobial activities both in vivo and in vitro. It can stop biofilm formation and appears to be non-toxic to eukaryotic cells)
    Tet-20
  • HY-P5391

    Bacterial Others
    LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)
    LL-37(17-32)
  • HY-P5483

    Bacterial Others
    Retro-indolicidin is a biological active peptide. (Reverse peptide of indolicidin (Rev4) is a 13-amino acid residue peptide based on the sequence of indolicidin. Indolicidin, a member of the cathelicidin protein family, is a 13-amino acid residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. The synthetic peptide Rev4 has been shown to possess strong antimicrobial as well as protease inhibitory activities in vitro.)
    Retro-indolicidin
  • HY-P5057B

    Fluorescent Dye Bacterial Infection
    5-FAM-Ahx-LL-37 TFA is a 5-FAM (HY-66022) labeled LL-37, human (HY-P1222). The carboxyfluorescein group is attached via a 6-carbon spacer, 6-Aminohexanoic acid (Ahx, HY-B0236). LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity .
    5-FAM-Ahx-LL-37 TFA
  • HY-P5446

    Bacterial Others
    BMAP-18 is a biological active peptide. (BMAP-18 is a truncated form of the antimicrobial peptide BMAP-27. Bovine myeloid antimicrobial peptide-27 (BMAP-27) belongs to the Cathelicidin family of peptides which displays rapid bactericidal activity against Staphylococcus aureus, Streptococcus uberis, and Escherichia coli. BMAP-27 is cytotoxic to human erythrocytes and neutrophils, although at higher than microbicidal concentrations. BMAP-18 displays much higher cell selectivity as compared to parental BMAP-27 because of its decreased hemolytic activity and retained antimicrobial activity.)
    BMAP-18

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: