1. Anti-infection
  2. Bacterial
  3. LL-37, human acetate

LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

LL-37, human acetate

LL-37, human acetate Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 4 publication(s) in Google Scholar

Other Forms of LL-37, human acetate:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing[1][2][3].

In Vitro

LL-37, human acetate (1-20 μg/mL; 24 h) affects HCECs migration[2].
LL-37, human acetate (0.0001-5 μg/mL;6-24 h) affects cytokine secretion in HCECs[2].
LL-37, human acetate (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg/mL[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Migration Assay [2]

Cell Line: Human corneal epithelial cell (HCEC)
Concentration: 1, 2.5, 5, 10 and 20 μg/mL
Incubation Time: 24 hours
Result: Dose-dependently stimulated HCEC migration but showed no effect on cells proliferation.

Cell Viability Assay[2]

Cell Line: Human corneal epithelial cell (HCEC)
Concentration: 0.0001, 0.001, 0.01, 0.1, 0.5, 1, and 5 μg/mL
Incubation Time: 6 and 24 hours
Result: Dose-dependently increased IL-8, IL-6, IL-1β and TNF-α secretion at 6 and 24 hours in HCEC.
In Vivo

LL-37, human acetate (0.4-2.0 mg/kg; intratracheal injection once) ameliorates MRSA-induced pneumonia of mice[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: 6-8 week-old C57BL/6 mice with MRSA-induced pneumonia[3]
Dosage: 0.4, 0.8, 1.2, 1.6 and 2.0 mg/kg
Administration: Intratracheal injection; 0.4-2.0 mg/kg once
Result: Decreased IL-6 and TNF-α release to attenuated MRSA-induced pneumonia of testing mice.
Molecular Weight

4493.26 (free base)

Formula

C205H340N60O53

Appearance

Solid

Color

White to off-white

Sequence

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

Sequence Shortening

[LL-37, 37 aa]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (Need ultrasonic)

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LL-37, human acetate
Cat. No.:
HY-P1222B
Quantity:
MCE Japan Authorized Agent: