Search Result

Results for "

NMDARs

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Akt (2) Amino Acid Derivatives (5) Amyloid-β (3) Apoptosis (5) ATP Citrate Lyase (1) Autophagy (2) Bacterial (1) Calcium Channel (19) Calmodulin (1) CaMK (1) Cholinesterase (ChE) (3) DAPK (1) Dopamine Transporter (1) Endogenous Metabolite (25) ERK (2) Free Fatty Acid Receptor (1) GABA Receptor (2) Glutathione S-transferase (1) HDAC (1) HIV (1) iGluR (93) Imidazoline Receptor (2) Isotope-Labeled Compounds (14) LXR (1) mGluR (3) Monoamine Transporter (1) mTOR (5) nAChR (2) NO Synthase (4) Opioid Receptor (1) P-glycoprotein (1) p38 MAPK (1) Phytohormone (2) PI3K (2) PKC (2) Potassium Channel (2) Reactive Oxygen Species (ROS) (1) Reference Standards (9) Serotonin Transporter (4) Tau Protein (3) TNF Receptor (2) TRP Channel (4)
By Research Areas:	Cancer (4) Cardiovascular Disease (1) Infection (2) Inflammation/Immunology (7) Metabolic Disease (25) Neurological Disease (78)

By Targets:

Akt (2)

Amino Acid Derivatives (5)

Amyloid-β (3)

Apoptosis (5)

ATP Citrate Lyase (1)

Autophagy (2)

Bacterial (1)

Calcium Channel (19)

Calmodulin (1)

CaMK (1)

Cholinesterase (ChE) (3)

DAPK (1)

Dopamine Transporter (1)

Endogenous Metabolite (25)

ERK (2)

Free Fatty Acid Receptor (1)

GABA Receptor (2)

Glutathione S-transferase (1)

HDAC (1)

HIV (1)

iGluR (93)

Imidazoline Receptor (2)

Isotope-Labeled Compounds (14)

LXR (1)

mGluR (3)

Monoamine Transporter (1)

mTOR (5)

nAChR (2)

NO Synthase (4)

Opioid Receptor (1)

P-glycoprotein (1)

p38 MAPK (1)

Phytohormone (2)

PI3K (2)

PKC (2)

Potassium Channel (2)

Reactive Oxygen Species (ROS) (1)

Reference Standards (9)

Serotonin Transporter (4)

Tau Protein (3)

TNF Receptor (2)

TRP Channel (4)

By Research Areas:

Cancer (4)

Cardiovascular Disease (1)

Infection (2)

Inflammation/Immunology (7)

Metabolic Disease (25)

Neurological Disease (78)

103

Inhibitors & Agonists

Peptides

Inhibitory Antibodies

Natural
Products

Isotope-Labeled Compounds

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-107498

GNE-8324	iGluR	Neurological Disease
GNE-8324 is a selective GluN2A positive allosteric modulator. GNE-8324 selectively enhances **NMDA receptor (NMDAR)**-mediated synaptic responses in inhibitory but not excitatory neurons .

HY-B1488

Tacrine hydrochloride 5 Publications Verification	Cholinesterase (ChE) iGluR	Neurological Disease
Tacrine hydrochloride is a potent inhibitor of both AChE and BChE, with IC₅₀s of 31 nM and 25.6 nM, respectively. Tacrine hydrochloride is also a *NMDAR* inhibitor, with an IC₅₀ of 26 μM. Tacrine hydrochloride can be used for the research of Alzheimer’s disease .

HY-129527

GNE-9278	iGluR	Neurological Disease
GNE-9278 is a highly selective positive allosteric modulator of *NMDAR* that acts at the GluN1 transmembrane domain (TMD). GNE-9278 acts on activated *NMDARs* to increase peak current and agonist affinity .

HY-P991611

ART5803	iGluR	Inflammation/Immunology
ART5803 is a humanized IgG1 monoclonal antibody inhibitor targeting *NMDAR. ART5803 binds to the N-terminal domain (NTD) of the NMDAR* GluN1 subunit (GluN1-NTD) with a high affinity. ART5803 blocks NMDAR internalization induced by pathogenic autoantibodies and restores cell-surface NMDAR expression and functions. ART5803 reverses behavioral abnormalities and NMDAR expression in marmoset disease models. ABT-147 can be used to study anti-NMDAR encephalitis .

HY-P10357

TAT-CBD3	HIV iGluR	Infection Inflammation/Immunology
TAT-CBD3, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .

HY-157476

AChE-IN-53	iGluR	Neurological Disease
AChE-IN-53 (Compound I-52) is a potent *NMDAR* inhibitor, which is a compound with favorable behavioral and neuroprotective effects .

HY-100802

Homoquinolinic acid	iGluR	Neurological Disease
Homoquinolinic acid is a non endogenous agonist of *NMDAR2* receptor .

HY-P11117

TAT-EE3	TRP Channel iGluR Calcium Channel	Neurological Disease
TAT-EE3 is a neuroprotective peptide which can uncouple *TRPM2-NMDARs* interaction. TAT-EE3 inhibits TRPM2-induced enhancement of *NMDAR* surface expression and current amplitude.TAT-EE3 protects neurons against ischemic injury in vitro and in vivo. TAT-EE3can be used for the study of ischemic stroke .

HY-173398

NMDAR antagonist 5	iGluR Monoamine Transporter Serotonin Transporter Dopamine Transporter	Neurological Disease
NMDAR antagonist 5 (Compound A17) is a multi-target antagonist against *NMDAR* and monoamine transporters (SERT、DAT and NET). NMDAR antagonist 5 shows good NMDAR antagonistic potency (IC₅₀ = 0.3 μM) and monoamine transporter activities (SERT IC₅₀ = 1.1 μM、DAT IC₅₀ = 0.7 μM、NET IC₅₀ = 2.7 μM). NMDAR antagonist 5 is highly safe and has low toxicity (hepatotoxicity and nephrotoxicity (IC₅₀ > 100 μM); cardiotoxicity (IC₅₀ = 24.5 μM)). NMDAR antagonist 5 has antidepressant effects and can be used in the study of depression .

HY-172884

MDAR-IN-1	Cholinesterase (ChE) iGluR	Neurological Disease
MDAR IN-1 (Compound 5m) is a brain-penetrant inhibitor of acetylcholinesterase (AChE) and antagonist of the GluN1/GluN2B subtype of *NMDAR* receptor. MDAR IN-1 effectively inhibits AChE activity, enhances cholinergic neurotransmission, and blocks NMDAR, reducing excitatory neurotoxicity. MDAR IN-1 is promising for research of Alzheimer's disease .

HY-B1488R

Tacrine hydrochloride (Standard)	Reference Standards Cholinesterase (ChE) iGluR	Neurological Disease
Tacrine (hydrochloride) (Standard) is the analytical standard of Tacrine (hydrochloride). This product is intended for research and analytical applications. Tacrine hydrochloride is a potent inhibitor of both AChE and BChE, with IC50s of 31 nM and 25.6 nM, respectively. Tacrine hydrochloride is also a NMDAR inhibitor, with an IC50 of 26 μM. Tacrine hydrochloride can be used for the research of Alzheimer’s disease .

HY-16940

24(S)-Hydroxycholesterol 24S-OHC; 24S-HC; Cerebrosterol	LXR iGluR Endogenous Metabolite	Metabolic Disease
24(S)-Hydroxycholesterol (24S-OHC), the major brain cholesterol metabolite, plays an important role to maintain homeostasis of cholesterol in the brain. 24(S)-Hydroxycholesterol (24S-OHC) is one of the most efficient endogenous LXR agonist known and is present in the brain and in the circulation at relatively high levels. 24(S)-Hydroxycholesterol (24S-OHC) is a very potent, direct, and selective positive allosteric modulator of *NMDARs* with a mechanism that does not overlapthat of other allosteric modulators .

HY-P2471

Neurogranin (48-76), mouse	Calmodulin	Neurological Disease
Neurogranin (48-76), mouse is a peptide corresponding to residues 48-76 of Neurogranin. Neurogranin, a calmodulin-binding protein, is exclusively expressed in the post-synapse, and mediates NMDAR driven synaptic plasticity by regulating the calcium-calmodulin (Ca ²⁺-CaM) pathway .

HY-17001

Flupirtine Maleate 1 Publications Verification	Potassium Channel iGluR	Neurological Disease
Flupirtine Maleate is a brain penetrant, and orally bioavailable, non-opioid and centrally acting analgesic agent. Flupirtine Maleate is an indirect N-methyl-D-aspartate receptor (NMDAR) antagonist. Neuroprotective properties .

HY-W001158

N,N-Dimethylglycine hydrochloride 1 Publications Verification Dimethylglycine hydrochloride; DMG hydrochloride; N-Methylsarcosine hydrochloride	Endogenous Metabolite iGluR Amino Acid Derivatives	Neurological Disease Metabolic Disease
N,N-Dimethylglycine (Dimethylglycine) hydrochloride, a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine hydrochloride is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine hydrochloride has antidepressant-like and surfactant effects .

HY-Y0511

N,N-Dimethylglycine 1 Publications Verification Dimethylglycine; DMG; N-Methylsarcosine	Endogenous Metabolite iGluR Amino Acid Derivatives	Neurological Disease Metabolic Disease
N,N-Dimethylglycine (Dimethylglycine), a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine has antidepressant-like and surfactant effects .

HY-17001R

Flupirtine Maleate (Standard)	Reference Standards Potassium Channel iGluR	Neurological Disease
Flupirtine (Maleate) (Standard) is the analytical standard of Flupirtine (Maleate). This product is intended for research and analytical applications. Flupirtine Maleate is a brain penetrant, and orally bioavailable, non-opioid and centrally acting analgesic agent. Flupirtine Maleate is an indirect N-methyl-D-aspartate receptor (NMDAR) antagonist. Neuroprotective properties .

HY-111500

*(Rac)-NMDAR* antagonist 1**	iGluR	Neurological Disease
(Rac)-NMDAR antagonist 1 is the racemate of NMDAR antagonist 1. NMDAR antagonist 1 is a potent and orally bioavailable NR2B-selective *NMDAR* antagonist .

HY-W008038R

NMDAR antagonist 3 (Standard)	iGluR	Others
NMDAR antagonist 3 (Standard) is the analytical standard of NMDAR antagonist 3. This product is intended for research and analytical applications. NMDAR antagonist 3 (Compound 2) is an antagonist of the NMDA receptor. NMDAR antagonist 3 has a certain but weak inhibitory activity against the NR1A/2B subtype of the NMDA receptor .

HY-111500A

NMDAR antagonist 1	iGluR	Neurological Disease
NMDAR antagonist 1 is a potent and orally bioavailable NR2B-selective *NMDAR* antagonist .

HY-149967

*GluN2B-NMDAR* antagonist-1**	iGluR	Neurological Disease Inflammation/Immunology
GluN2B-NMDAR antagonist-1 is an orally active *GluN2B-NMDAR* antagonist. GluN2B-NMDAR antagonist-1 has neuroprotective activity. GluN2B-NMDAR antagonist-1 can be used for research of ischemic injury .

HY-147873

NMDAR/HDAC-IN-1	iGluR HDAC	Neurological Disease
NMDAR/HDAC-IN-1 (Compound 9d) is a dual *NMDAR* and HDAC inhibitor with a K_i of 0.59 μM for NMDAR and IC₅₀ values of 2.67, 8.00, 2.21, 0.18 and 0.62 μM for HDAC1, HDAC2, HDAC3, HDAC6 and HDAC8, respectively. NMDAR/HDAC-IN-1 efficiently penetrates the blood brain barrier .

HY-N1916

Coniferyl ferulate	Glutathione S-transferase P-glycoprotein Apoptosis iGluR CaMK p38 MAPK Reactive Oxygen Species (ROS) Bacterial	Infection Cardiovascular Disease Neurological Disease Inflammation/Immunology Cancer
Coniferyl ferulate is an orally active phenolic acid compound. Coniferyl ferulate is a potent inhibitor of glutathione S-transferase (GST) (IC₅₀ = 0.3 μM), which downregulates P-gp expression, induces apoptosis in B-MD-C1 (ADR+/+) cells, and reverses multidrug resistance. Coniferyl ferulate blocks the *NMDAR/NR2B-CaMKII-MAPKs* signaling pathway, inhibits ROS production and mitochondrial apoptosis, while reshapes the intestinal microbiota and microbial metabolism, ameliorates colonic inflammation and alleviates depressive symptoms in mice. Coniferyl ferulate can alleviate the toxicity of xylene to hematopoietic stem and progenitor cells by targeting Mgst2. Coniferyl ferulate exhibits antibacterial activity against the Gram-positive Bacillus subtilis and Staphylococcus aureus .

HY-157936

*GluN2B-NMDAR* antagonist-2**	iGluR	Neurological Disease
GluN2B-NMDAR antagonist-2 (compound S-58) is a potent, selective and cross the blood-brain barrier *NMDAR-GluN2B* antagonist with an IC₅₀ value of 74.01, nM. GluN2B-NMDAR antagonist-2 shows mild cytotoxicity. GluN2B-NMDAR antagonist-2 decreases the cerebral infarction rates and neurologic deficit scores. GluN2B-NMDAR antagonist-2 has the potential for the research of stroke .

HY-P5912

GluN1(356-385)	iGluR	Neurological Disease
GluN1 (356-385) is an antigenic peptide against N-methyl-D-aspartate receptor (NMDAR) encephalitis. GluN1 (356-385) has the effect of reducing the density of surface NMDAR clusters in hippocampal neurons. GluN1 (356-385) can be used to study the pathogenesis of anti-NMDAR encephalitis .

HY-168240

NMDAR antagonist 2	iGluR	Neurological Disease
NMDAR antagonist 2 (compound 3I) is a CNS penetrant *NMDAR* antagonist with the IC₅₀ of 4.42 μM and 214.75 μM for hGluN1/hGluN2A at −60 mV or 40 mV membrane potentials, respectively. NMDAR antagonist 2 can reduce hippocampal damage .

HY-15786

SGE-201	iGluR	Neurological Disease
SGE-201 is an allosteric modulator of N-methyl-D-aspartate receptors (NMDARs), demonstrating significant neuroprotective effects by enhancing NMDAR-mediated responses while differing in action among various blockers in neuronal networks.

HY-W008038

NMDAR antagonist 3	iGluR	Others
NMDAR antagonist 3 (Compound 2) is an antagonist of the *NMDA* receptor. NMDAR antagonist 3 has a certain but weak inhibitory activity against the NR1A/2B subtype of the *NMDA* receptor .

HY-16728A

Rapastinel acetate GLYX-13 acetate	iGluR	Neurological Disease
Rapastinel acetate (GLYX-13 acetate) is an N-methyl-D-aspartate (NMDA) receptor modulator with long-acting antidepressant activity. Rapastinel acetate exerts its antidepressant effects by enhancing long-term potentiation (LTP) of synaptic transmission. Rapastinel acetate transiently enhances NMDAR-mediated currents in pyramidal neurons in the hippocampus and medial prefrontal cortex by binding to unique sites on the NMDAR complex. Rapastinel acetate significantly enhanced NMDAR-mediated currents at a concentration of 1 μmol/l and significantly reduced the currents at a concentration of 10 μmol/l. The mechanism of action of Rapastinel acetate is related to the reduction of affinity to intracellular calcium inactivation sites, which provides a theoretical basis for enhancing conductance mediated by NMDAR .

HY-129517

UBP714	iGluR	Neurological Disease
UBP714 exhibts agonistic activity for recombinant GluN1/GluN2 receptor by binding to the positive allosteric site (PAM) of NMDARs. UBP714 enhances NMDAR-mediated field excitatory postsynaptic potentials (f-EPSPs) in Xenopus oocytes .

HY-155810

DQP-26	iGluR	Neurological Disease
DQP-26 is a potent *NMDAR* negative allosteric modulator with IC₅₀ values of 0.77 μM and 0.44 μM for GluN2C and GluN2D, respectively. DQP-26 has the potential for NMDAR-associated neurological disease research .

HY-P5911

GluN1(359-378)	iGluR	Inflammation/Immunology
GluN1 (359-378) is an anti-N-methyl-D-aspartate receptor (NMDAR) peptide. GluN1 (359-378) can cross the blood-brain barrier. GluN1 (359-378) can be used to study anti-NMDAR encephalitis therapy targeting the immune system .

HY-106397

Delucemine NPS-1506	Serotonin Transporter iGluR	Neurological Disease
Delucemine is a selective serotonin reuptake inhibitor (SSRI) and NMDAR antagonist. Delucemine can be used as an antidepressant .

HY-106397A

Delucemine hydrochloride NPS-1506 hydrochloride	Serotonin Transporter iGluR	Neurological Disease
Delucemine hydrochloride is a selective serotonin reuptake inhibitor (SSRI) and NMDAR antagonist. Delucemine hydrochloride can be used as an antidepressant .

HY-111973

Phaseic acid	Phytohormone iGluR	Neurological Disease
Phaseic acid is a Abscisic acid terpenoid catabolite that can able to activate a subset of Abscisic acid repectors. Phaseic acid is a plant hormone associated with photosynthesis arrest and abscission. Phaseic acid is the antagonist for NMDA-type glutamate receptor (NMDAR) that inhibits NMDAR currents with an IC₅₀ of 34.37 μM. Phaseic acid reduces intracellular calcium influx, and exhibits neuroprotective effect .

HY-100808

D-Serine 1 Publications Verification (R)-Serine	iGluR Endogenous Metabolite	Neurological Disease
D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration .

HY-13457

TCN 201 1 Publications Verification	iGluR	Neurological Disease
TCN 201 is a potent, selective and non-competitive antagonist of *GluN1/GluN2A NMDA* receptor, with a pIC₅₀** of 6.8. TCN 201 is selective for GluN1/GluN2A NMDA receptor over GluN1/GluN2B NMDA receptor (pIC₅₀<4.3) .

HY-172261

YY-23	iGluR	Neurological Disease
YY-23 is a selective inhibitor of *NMDAR* (containing GluN2C or GluN2D). YY-23 inhibits GABAergic neurotransmission and enhances excitatory transmission by inhibiting *NMDARs* containing GluN2D on GABAergic interneurons in the prefrontal cortex. YY-23 has antidepressant activity and can be used for the research of neurological diseases .

HY-107712

TCN 213	iGluR	Neurological Disease
TCN 213 is a selective, surmountable, glycine-dependentlly GluN1/GluN2A NMDAR antagonist with IC₅₀s of 0.55, 3.5, 40 μM in the presence of 75, 750, 7500 nM glycine, respectively. TCN 213 can be used to monitor, pharmacologically, the switch in NMDAR expression in developing cortical neurones .

HY-107705

NMDAR antagonist 4	iGluR	Neurological Disease
NMDAR antagonist 4 (Compound 8) is the antagonist for NMDA receptor that binds NMDA receptor on glycine site with K_i >100 μM .

HY-100457

IC87201 2 Publications Verification	iGluR	Neurological Disease
IC87201, an inhibitor of PSD95-nNOS protein-protein interactions, suppresses *NMDAR*-dependent NO and cGMP formation.

HY-16728

Rapastinel 1 Publications Verification GLYX-13	iGluR	Neurological Disease
Rapastinel (GLYX-13) is an N-methyl-D-aspartate receptor (NMDAR) modulator that has characteristics of a glycine site partial agonist.

HY-111973S3

Phaseic acid-d4	Isotope-Labeled Compounds Phytohormone iGluR	Others
Phaseic acid-d₄ is the deuterium labeled Phaseic acid. Phaseic acid is a Abscisic acid terpenoid catabolite that can able to activate a subset of Abscisic acid repectors. Phaseic acid is a plant hormone associated with photosynthesis arrest and abscission. Phaseic acid is the antagonist for NMDA-type glutamate receptor (NMDAR) that inhibits NMDAR currents with an IC₅₀ of 34.37 μM. Phaseic acid reduces intracellular calcium influx, and exhibits neuroprotective effect .

HY-107423

GNE 6901	iGluR	Neurological Disease
GNE 6901 (compound 40) is a potent GluN2A-selective NMDAR positive allosteric modulator (PAM) with an EC₅₀ of 382 nM .

HY-100667

UBP608 1 Publications Verification	iGluR	Neurological Disease
UBP608 is a potent N-Methyl-D-aspartate receptors (NMDARs) negative allosteric modulator. UBP608 has the potential for the research of neurological disorders .

HY-100808R

D-Serine (Standard) (R)-Serine (Standard)	Reference Standards iGluR Endogenous Metabolite	Neurological Disease
D-Serine (Standard) is the analytical standard of D-Serine. This product is intended for research and analytical applications. D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration[1][2].

HY-P2307

Tat-NR2Baa	iGluR NO Synthase	Neurological Disease
Tat-NR2BAA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .

HY-P2307A

Tat-NR2Baa TFA	iGluR NO Synthase	Neurological Disease
Tat-NR2BAA TFA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA TFA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .

HY-100808S

D-Serine-d3 (R)-Serine-d₃	Isotope-Labeled Compounds Endogenous Metabolite iGluR	Neurological Disease
D-Serine-d₃ ((R)-Serine-d₃) is a deuterium labeled D-Serine (HY-100808). D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration .

HY-B0591

Memantine Maximum Cited Publications 9 Publications Verification	iGluR	Neurological Disease
Memantine is an orally active, noncompetitive N-methyl-D-aspartate receptor *(NMDAR)* antagonist. Memantine can be used for the research of moderate-to-severe Alzheimer's disease (AD) .

Cat. No.	Product Name	Target	Research Area

HY-W001158

N,N-Dimethylglycine hydrochloride 1 Publications Verification Dimethylglycine hydrochloride; DMG hydrochloride; N-Methylsarcosine hydrochloride	Endogenous Metabolite iGluR Amino Acid Derivatives	Neurological Disease Metabolic Disease
N,N-Dimethylglycine (Dimethylglycine) hydrochloride, a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine hydrochloride is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine hydrochloride has antidepressant-like and surfactant effects .

HY-P5912

GluN1(356-385)	iGluR	Neurological Disease
GluN1 (356-385) is an antigenic peptide against N-methyl-D-aspartate receptor (NMDAR) encephalitis. GluN1 (356-385) has the effect of reducing the density of surface NMDAR clusters in hippocampal neurons. GluN1 (356-385) can be used to study the pathogenesis of anti-NMDAR encephalitis .

HY-P5911

GluN1(359-378)	iGluR	Inflammation/Immunology
GluN1 (359-378) is an anti-N-methyl-D-aspartate receptor (NMDAR) peptide. GluN1 (359-378) can cross the blood-brain barrier. GluN1 (359-378) can be used to study anti-NMDAR encephalitis therapy targeting the immune system .

HY-P2307

Tat-NR2Baa	iGluR NO Synthase	Neurological Disease
Tat-NR2BAA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .

HY-P0117

Tat-NR2B9c Maximum Cited Publications 8 Publications Verification Tat-NR2Bct; NA-1	iGluR NO Synthase	Neurological Disease
Tat-NR2B9c (Tat-NR2Bct; NA-1) is a postsynaptic density-95 (PSD-95) inhibitor, with EC₅₀ values of 6.7 nM and 670 nM for PSD-95d2 (PSD-95 PDZ domain 2) and PSD-95d1, respectively. Tat-NR2B9c disrupts the PSD-95/NMDAR interaction, inhibiting NR2A and NR2B binding to PSD-95 with IC₅₀ values of 0.5 μM and 8 μM, respectively. Tat-NR2B9c also inhibits neuronal nitric oxide synthase (nNOS)/PSD-95 interaction, and possesses neuroprotective efficacy .

HY-P10357

TAT-CBD3	HIV iGluR	Infection Inflammation/Immunology
TAT-CBD3, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .

HY-P11117

TAT-EE3	TRP Channel iGluR Calcium Channel	Neurological Disease
TAT-EE3 is a neuroprotective peptide which can uncouple *TRPM2-NMDARs* interaction. TAT-EE3 inhibits TRPM2-induced enhancement of *NMDAR* surface expression and current amplitude.TAT-EE3 protects neurons against ischemic injury in vitro and in vivo. TAT-EE3can be used for the study of ischemic stroke .

HY-P2471

Neurogranin (48-76), mouse	Calmodulin	Neurological Disease
Neurogranin (48-76), mouse is a peptide corresponding to residues 48-76 of Neurogranin. Neurogranin, a calmodulin-binding protein, is exclusively expressed in the post-synapse, and mediates NMDAR driven synaptic plasticity by regulating the calcium-calmodulin (Ca ²⁺-CaM) pathway .

HY-P2307A

Tat-NR2Baa TFA	iGluR NO Synthase	Neurological Disease
Tat-NR2BAA TFA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA TFA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .

HY-P7060

NT 13 TPPT	iGluR	Neurological Disease
NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. NT 13 is a partial N-methyl-D-aspartate receptor (NMDAR) agonist used in the study of depression, anxiety, and other related diseases.

HY-P0117A

Tat-NR2B9c TFA Maximum Cited Publications 8 Publications Verification Tat-NR2Bct TFA; NA-1 TFA	iGluR NO Synthase	Neurological Disease
Tat-NR2B9c TFA (Tat-NR2Bct TFA) is a postsynaptic density-95 (PSD-95) inhibitor, with EC₅₀ values of 6.7 nM and 670 nM for PSD-95d2 (PSD-95 PDZ domain 2) and PSD-95d1, respectively. Tat-NR2B9c TFA disrupts the PSD-95/NMDAR interaction, inhibiting NR2A and NR2B binding to PSD-95 with IC₅₀ values of 0.5 μM and 8 μM, respectively. Tat-NR2B9c TFA also inhibits neuronal nitric oxide synthase (nNOS)/PSD-95 interaction, and possesses neuroprotective efficacy .

HY-P5277

TAT-GluN2BCTM	DAPK	Neurological Disease
TAT-GluN2BCTM is a membrane-permeable DAPK1-targeting peptide. TAT-GluN2BCTM targets active DAPK1 to lysosomes for degradation. TAT-GluN2BCTM protects neurons from oxidative stress and NMDAR-mediated excitotoxicity by knocking down DAPK1. TAT-GluN2BCTM can be used in the study of neuroprotection .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

Cat. No.	Product Name	Target	Research Area

HY-P991611

ART5803	iGluR	Inflammation/Immunology
ART5803 is a humanized IgG1 monoclonal antibody inhibitor targeting *NMDAR. ART5803 binds to the N-terminal domain (NTD) of the NMDAR* GluN1 subunit (GluN1-NTD) with a high affinity. ART5803 blocks NMDAR internalization induced by pathogenic autoantibodies and restores cell-surface NMDAR expression and functions. ART5803 reverses behavioral abnormalities and NMDAR expression in marmoset disease models. ABT-147 can be used to study anti-NMDAR encephalitis .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-16940

24(S)-Hydroxycholesterol 24S-OHC; 24S-HC; Cerebrosterol	Structural Classification Classification of Application Fields Source classification Disease markers Metabolic Disease Nervous System Disorder Endogenous metabolite Disease Research Fields Steroids	LXR iGluR Endogenous Metabolite
24(S)-Hydroxycholesterol (24S-OHC), the major brain cholesterol metabolite, plays an important role to maintain homeostasis of cholesterol in the brain. 24(S)-Hydroxycholesterol (24S-OHC) is one of the most efficient endogenous LXR agonist known and is present in the brain and in the circulation at relatively high levels. 24(S)-Hydroxycholesterol (24S-OHC) is a very potent, direct, and selective positive allosteric modulator of *NMDARs* with a mechanism that does not overlapthat of other allosteric modulators .

HY-Y0511

N,N-Dimethylglycine 1 Publications Verification Dimethylglycine; DMG; N-Methylsarcosine	Structural Classification Microorganisms Other disease Classification of Application Fields Source classification Disease markers Other Diseases Amino acids Endogenous metabolite Disease Research Fields	Endogenous Metabolite iGluR Amino Acid Derivatives
N,N-Dimethylglycine (Dimethylglycine), a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine has antidepressant-like and surfactant effects .

HY-N1916

Coniferyl ferulate	Structural Classification Classification of Application Fields Simple Phenylpropanols Source classification Phenols Polyphenols Dicerothamnus rhinocerotis Phenylpropanoids Umbelliferae Plants Disease Research Fields Cancer	Glutathione S-transferase P-glycoprotein Apoptosis iGluR CaMK p38 MAPK Reactive Oxygen Species (ROS) Bacterial
Coniferyl ferulate is an orally active phenolic acid compound. Coniferyl ferulate is a potent inhibitor of glutathione S-transferase (GST) (IC₅₀ = 0.3 μM), which downregulates P-gp expression, induces apoptosis in B-MD-C1 (ADR+/+) cells, and reverses multidrug resistance. Coniferyl ferulate blocks the *NMDAR/NR2B-CaMKII-MAPKs* signaling pathway, inhibits ROS production and mitochondrial apoptosis, while reshapes the intestinal microbiota and microbial metabolism, ameliorates colonic inflammation and alleviates depressive symptoms in mice. Coniferyl ferulate can alleviate the toxicity of xylene to hematopoietic stem and progenitor cells by targeting Mgst2. Coniferyl ferulate exhibits antibacterial activity against the Gram-positive Bacillus subtilis and Staphylococcus aureus .

HY-100808

D-Serine 1 Publications Verification (R)-Serine	Structural Classification Human Gut Microbiota Metabolites Microorganisms Source classification Amino acids Endogenous metabolite	iGluR Endogenous Metabolite
D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration .

HY-N0215

L-Phenylalanine 5 Publications Verification Phenylalanine	Structural Classification Microorganisms Animals Classification of Application Fields Source classification Metabolic Disease Amino acids Endogenous metabolite Disease Research Fields	Calcium Channel iGluR Endogenous Metabolite
L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca ⁺ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (K_B of 573 μM ) and *non-NMDARs*, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N11978

6-Hydroxykynurenic acid 6-HKA	Structural Classification Ginkgoaceae Ketones, Aldehydes, Acids Source classification Plants Ginkgo biloba	iGluR
6-Hydroxykynurenic acid (6-HKA) is a derivative of kynurenic acid (KYNA) and can be isolated from Ginkgo leaves. 6-Hydroxykynurenic acid is a low-affinity NMDAR antagonist (IC₅₀: 59 μM) .

HY-N0215R

L-Phenylalanine (Standard) Phenylalanine (Standard)	Structural Classification Microorganisms Animals Source classification Amino acids Endogenous metabolite	Reference Standards Calcium Channel iGluR Endogenous Metabolite
L-Phenylalanine (Standard) is the analytical standard of L-Phenylalanine. This product is intended for research and analytical applications. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0837

Veratramine 1 Publications Verification NSC17821; NSC23880	Alkaloids Piperidine Alkaloids Structural Classification other families Classification of Application Fields Source classification Plants Disease Research Fields Cancer	PI3K Akt mTOR Autophagy Apoptosis
Veratramine (NSC17821; NSC23880) is an orally active inhibitor of the PI3K/Akt/mTOR signaling pathway and a SIGMAR1 modulator. Veratramine induces autophagic apoptosis of tumor cells, arrests the cell cycle at the G0/G1 phase, and inhibits epithelial-mesenchymal transition (EMT)-related proteins to reduce tumor migration. Veratramine reduces spinal cord and sciatic nerve pathological damage in a neuropathy model by inhibiting SIGMAR1 binding to *NMDAR* and phosphorylation of NMDAR Ser896. Veratramine has anti-tumor proliferation, apoptosis induction, anti-inflammatory and neuroprotective activities, and can be used in the study of cancers such as liver cancer and osteosarcoma, as well as diabetic peripheral neuropathy .

HY-100808R

D-Serine (Standard) (R)-Serine (Standard)	Structural Classification Human Gut Microbiota Metabolites Microorganisms Source classification Amino acids Endogenous metabolite	Reference Standards iGluR Endogenous Metabolite
D-Serine (Standard) is the analytical standard of D-Serine. This product is intended for research and analytical applications. D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration[1][2].

HY-N11061

Withaphysalin D	Structural Classification Physalis minima Linn. Source classification Plants Solanaceae Steroids	iGluR
Withaphysalin D is a selective antagonist against the N-methyl-D-aspartate receptor (NMDAR) containing GluN2B. Withaphysalin D can be isolated from water lilies and has neuroprotective properties. Withaphysalin D is able to cross the blood-brain barrier .

HY-N0837R

Veratramine (Standard) NSC17821 (Standard); NSC23880 (Standard)	Alkaloids Piperidine Alkaloids Structural Classification other families Source classification Plants	Reference Standards PI3K Akt mTOR Autophagy Apoptosis
Veratramine (NSC17821; NSC23880) (Standard) is the analytical standard of Veratramine (HY-N0837). This product is intended for research and analytical applications. Veratramine (NSC17821; NSC23880) is an orally active inhibitor of the PI3K/Akt/mTOR signaling pathway and a SIGMAR1 modulator. Veratramine induces autophagic apoptosis of tumor cells, arrests the cell cycle at the G0/G1 phase, and inhibits epithelial-mesenchymal transition (EMT)-related proteins to reduce tumor migration. Veratramine reduces spinal cord and sciatic nerve pathological damage in a neuropathy model by inhibiting SIGMAR1 binding to *NMDAR* and phosphorylation of NMDAR Ser896. Veratramine has anti-tumor proliferation, apoptosis induction, anti-inflammatory and neuroprotective activities, and can be used in the study of cancers such as liver cancer and osteosarcoma, as well as diabetic peripheral neuropathy .

HY-Y0511R

N,N-Dimethylglycine (Standard) Dimethylglycine (Standard); DMG (Standard); N-Methylsarcosine (Standard)	Structural Classification Microorganisms Other disease Source classification Disease markers Amino acids Endogenous metabolite	Reference Standards Endogenous Metabolite iGluR Amino Acid Derivatives
N,N-Dimethylglycine (Dimethylglycine) (Standard) is the analytical standard of N,N-Dimethylglycine (HY-Y0511). This product is intended for research and analytical applications. N,N-Dimethylglycine (Dimethylglycine), a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine has antidepressant-like and surfactant effects.

Cat. No.	Product Name	Chemical Structure

HY-100808S

D-Serine-d3

D-Serine-d₃ ((R)-Serine-d₃) is a deuterium labeled D-Serine (HY-100808). D-Serine ((R)-Serine), an endogenous amino acid involved in glia-synapse interactions that has unique neurotransmitter characteristics, is a potent co-agonist at the NMDA glutamate receptor. D-Serinee has a cardinal modulatory role in major NMDAR-dependent processes including NMDAR-mediated neurotransmission, neurotoxicity, synaptic plasticity, and cell migration .

HY-N0215S3

L-Phenylalanine-d2

L-Phenylalanine-d₂ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S

L-Phenylalanine-d7

L-Phenylalanine-d₇ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S1

L-Phenylalanine-d8

L-Phenylalanine-d₈ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S12

L-Phenylalanine-d5

1 Publications Verification

L-Phenylalanine-d₅ is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S7

L-Phenylalanine-3-13C

L-Phenylalanine-3- ¹³C is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S2

L-Phenylalanine-13C

L-Phenylalanine- ¹³C is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-111973S3

Phaseic acid-d4

Phaseic acid-d₄ is the deuterium labeled Phaseic acid. Phaseic acid is a Abscisic acid terpenoid catabolite that can able to activate a subset of Abscisic acid repectors. Phaseic acid is a plant hormone associated with photosynthesis arrest and abscission. Phaseic acid is the antagonist for NMDA-type glutamate receptor (NMDAR) that inhibits NMDAR currents with an IC₅₀ of 34.37 μM. Phaseic acid reduces intracellular calcium influx, and exhibits neuroprotective effect .

HY-N0215S6

DL-Phenylalanine-d5 hydrochloride

DL-Phenylalanine-d₅ (hydrochloride) is the deuterium labeled DL-Phenylalanine hydrochloride. L-Phenylalanine hydrochloride is an essential amino acid isolated from Escherichia coli. L-Phenylalanine hydrochloride is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine hydrochloride is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine hydrochloride is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S13

L-Phenylalanine-d1

L-Phenylalanine-d is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S5

L-Phenylalanine-15N

L-Phenylalanine- ¹⁵N is the ¹⁵N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S8

L-Phenylalanine-13C6

L-Phenylalanine- ¹³C₆ is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S10

L-Phenylalanine-13C9

L-Phenylalanine- ¹³C₉ is the ¹³C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-B0591S

Memantine-d3 hydrochloride
Memantine-d₃ (hydrochloride) is deuterium labeled Memantine. Memantine is an orally active, noncompetitive N-methyl-D-aspartate receptor (NMDAR) antagonist. Memantine can be used for the research of moderate-to-severe Alzheimer's disease (AD) .

HY-N0215S11

L-Phenylalanine-13C9,15N

L-Phenylalanine- ¹³C₉, ¹⁵N is the ¹³C- and ¹⁵N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S14

L-Phenylalanine-15N,d8

L-Phenylalanine- ¹⁵N,d₈ is the deuterium and ¹⁵N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca2+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-N0215S9

L-Phenylalanine-13C9,15N,d8

L-Phenylalanine- ¹³C₉, ¹⁵N,d₈ is the deuterium, ¹³C-, and 15-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a K_i of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals .

HY-W001158S1

N,N-Dimethylglycine-d3 hydrochloride

N,N-Dimethylglycine-d₃ (Dimethylglycine-d₃) hydrochloride is the deuterium labeled N,N-Dimethylglycine hydrochloride (HY-W001158). N,N-Dimethylglycine (Dimethylglycine) hydrochloride, a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine hydrochloride is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine hydrochloride has antidepressant-like and surfactant effects .

HY-W001158S

N,N-Dimethylglycine-d6 hydrochloride

N,N-Dimethylglycine-d₆ (Dimethylglycine-d₆) hydrochloride is the deuterium labeled N,N-Dimethylglycine hydrochloride (HY-W001158). N,N-Dimethylglycine (Dimethylglycine) hydrochloride, a natural N-methylated glycine, is a nutrient supplement and acts as an NMDAR glycine site partial agonist. N,N-Dimethylglycine hydrochloride is a methyl donor that can improve immunity, act as an antioxidant to prevent oxidative stress, and scavenge excess free radicals. N,N-Dimethylglycine hydrochloride has antidepressant-like and surfactant effects .

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社重松貿易株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks