2. Search Result
Search Result
Results for "

Lewis

" in MedChemExpress (MCE) Product Catalog:

65

Inhibitors & Agonists

1

Fluorescent Dye

11

Biochemical Assay Reagents

7

Peptides

4

Inhibitory Antibodies

16

Natural
Products

4

Oligonucleotides

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-N10535
    Lewis y tetrasaccharide

    Lewis y

    		 FAK Cancer
    Lewis Y tetrasaccharide (Lewis Y, Le Y) is a tetrasaccharide derivative form of Lewis X trisaccharide (HY-N10534). Lewis Y tetrasaccharide is an antigen associated with malignant ovarian carcinomas metastasis and poor prognosis .
    Lewis y tetrasaccharide
  • HY-N10534
    Lewis X trisaccharide

    Lewis X

    		 Parasite Infection Inflammation/Immunology Cancer
    Lewis X trisaccharide (Lewis X, Le x) is a potent TH2 regulator, antagonizes LPS-induced IL-12 immune expression. Lewis X trisaccharide is a human histo-blood group antigen, plays an key role in cell-cell adhesion, and servers as a tumor marker. Lewis X trisaccharide is highly expressed in the outer membrane of the parasite, can be used for the immunology research of schistosomiasis .
    Lewis X trisaccharide
  • HY-W020790
    Sialyl-Lewis X

    sLeX

    		 Endogenous Metabolite Inflammation/Immunology
    Sialyl-Lewis X (sLeX) is a sialylated fucosylated tetrasaccharide, an endogenous antigen. Sialyl-Lewis X is a high-affinity ligand for selectins (E-, P-, and L-selectin) . Sialyl-Lewis X binds to ELAM-1 and CD62 and has the ability?to inhibits CD62-mediated neutrophil recruitment to sites of inflammation .
    Sialyl-Lewis X
  • HY-N10531
    Lewis a trisaccharide

    Lewis a

    		 Others Others
    Lewis a trisaccharide (Lewis a) is a trisaccharide that has been found to be present in the glycan structures of spermatozoa. Lewis a trisaccharide also is a major component of the glycan structures on the surface of HL-60 cells .
    Lewis a trisaccharide
  • HY-N12918
    Lewis X tetrasaccharide

    		Others Infection
    Lewis X tetrasaccharide is a cell surface glycan that can be used for diagnosis of microbial infections.
    Lewis X tetrasaccharide
  • HY-W854445
    Lewis-b tetrasaccharide

    		Biochemical Assay Reagents Others
    Lewis-b tetrasaccharide is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology .
    Lewis-b tetrasaccharide
  • HY-W698344
    Lewis X Trisaccharide,Methyl Glycoside

    		Biochemical Assay Reagents Others
    Lewis X Trisaccharide,Methyl Glycoside is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology .
    Lewis X Trisaccharide,Methyl Glycoside
  • HY-W854385
    Sialyl Lewis A

    SLeA

    		 Biochemical Assay Reagents Cancer
    Sialyl Lewis A (SLeA) is a carbohydrate-type antigen that can serve as a tumor marker, with upregulation observed in various tumor cells such as cervical cancer, human pancreatic cancer, and colon cancer cells. Sialyl Lewis A is involved in the migration and adhesion of tumor cells. Additionally, elevated expression of Sialyl Lewis A may also lead to pregnancy abnormalities .
    Sialyl Lewis A
  • HY-W145535
    Sialyl lewis x-lactose

    		Biochemical Assay Reagents Endogenous Metabolite Others
    Sialyl Lewis X-Lactose is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
    Sialyl lewis x-lactose
  • HY-E70158
    Fucosyltransferase 9

    EC:2.4.1.152; FUT9

    		 Drug Intermediate Others
    Fucosyltransferase 9 (EC:2.4.1.152, FUT9) catalyzes the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. Fucosyltransferase 9 synthesizes the LeX oligosaccharide (CD15) .
    Fucosyltransferase 9
  • HY-W142631
    4-(Phenylazo)diphenylamine

    		Fluorescent Dye Cancer
    4-(Phenylazo)diphenylamine is an excellent colorimetric indicator for the accurate determination of the concentration for a variety of strong bases, Lewis acids, and hydride reducing agents .
    4-(Phenylazo)diphenylamine
  • HY-19015
    Probimane

    AT-2153

    		 Calmodulin Cancer
    Probimane (AT-2153) is a potent anticancer agent. Probimane is effective against mouse tumors S37, S180, Lewis lung carcinoma, L1210 and human pulmonary adenocarcinoma heterotransplanted into nude mice .
    Probimane
  • HY-P990622
    MB-311

    		Transmembrane Glycoprotein Inflammation/Immunology
    MB-311 is a humanized antibody expressed in CHO cells, targeting Lewis Y. MB-311 has a huIgG1 heavy chain and a huλ light chain, with a predicted molecular weight (MW) of 150 kDa. The isotype control for MB-311 can refer to Human IgG1 kappa, Isotype Control (HY-P99001).
    MB-311
  • HY-110288
    3FAx-Neu5Ac
    1 Publications Verification

    		 Sialyltransferase Metabolic Disease
    3FAx-Neu5Ac (Compound 8), a Sialic acid peracetylated analog, is a sialyltransferase inhibitor. 3FAx-Neu5Ac substantially reduces expression of the sialylated ligand sialyl Lewis X .
    3FAx-Neu5Ac
  • HY-P2045
    RA-VII

    		Arp2/3 Complex Cancer
    RA-VII is an antitumor agent that exhibits significant activity against L1210, B-16 melanoma, Lewis lung carcinoma, Colon 38 and Ehrlich carcinoma .
    RA-VII
  • HY-E70059
    alpha-1,2-Fucosyltransferase (α1,2FucT)

    		Glucosylceramide Synthase (GCS) Cancer
    alpha-1,2-Fucosyltransferase (α1,2FucT), i.e., alpha 1, 2-fucosyltransferase, is often used in biochemical studies. alpha-1,2-Fucosyltransferase is a rate-limiting enzyme, can catalyze the synthesis of Lewis y (a cell membrane-associated carbohydrate antigen) .
    alpha-1,2-Fucosyltransferase (α1,2FucT)
  • HY-162863
    ERK-MYD88 interaction inhibitor 1

    		Apoptosis Cancer
    ERK-MYD88 interaction inhibitor 1 is an ERK-MYD88 interaction inhibitor. ERK-MYD88 interaction inhibitor 1 can induce an HRI-mediated integrated stress response (ISR), leading to cancer cell-specific immunogenic cell apoptosis (apoptosis). ERK-MYD88 interaction inhibitor 1 can induce anti-tumor T cell responses in Lewis lung cancer mice, exhibiting anti-tumor activity .
    ERK-MYD88 interaction inhibitor 1
  • HY-W250111
    Carboxymethyl chitosan

    		Biochemical Assay Reagents Apoptosis Reactive Oxygen Species (ROS) Bcl-2 Family Caspase Cancer
    Carboxymethyl chitosan is a derivative of chitosan. Carboxymethyl chitosan inhibits Apoptosis and ROS. Carboxymethyl chitosan increases the expression of Bcl-2 and reduces the expression of Bax, cytochrome c and caspase-3. Carboxymethyl chitosan inhibits the migration of various cells. Carboxymethyl chitosan exerts antitumor effects on Lewis tumors and hepatocarcinoma .
    Carboxymethyl chitosan
  • HY-P991458
    hu3S193

    		Transmembrane Glycoprotein Cancer
    hu3S193 is a human IgG monoclonal antibody (mAb) targeting Lewis Y. hu3S193 has excellent immune effector function (complement-dependent cytotoxicity) (IC50: 1.0 μg/ml) and antibody-dependent cellular cytotoxicity (IC50: 5.0 μg/ml). hu3S193 can be used in small cell lung cancer (SCLC) research. Recommended isotype control: Human IgG1 kappa, Isotype Control (HY-P99001) .
    hu3S193
  • HY-E70156
    Fucosyltransferase 7

    EC:2.4.1.-; FUT7

    		 Biochemical Assay Reagents Others
    Fucosyltransferase 7 (FUT7) is a golgi stack membrane protein. Fucosyltransferase 7catalyzes the final fucosylation step in the synthesis of Lewis antigens and generates a unique glycosylated product sialyl Lewis X (sLeX). Fucosyltransferase 7 catalyzes alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens .
    Fucosyltransferase 7
  • HY-N7575
    Lacto-N-fucopentaose II

    LNFP II

    		 Endogenous Metabolite Metabolic Disease Cancer
    Lacto-N-fucopentaose II (LNFP II) is a sialyl-Lewis, hapten of human Lewis bloodgroup determinant. Lacto-N-fucopentaose II monosialo-ganglioside/glycolipid and sialyl derivative, CA 19-9, is a molecular tumour markers (TM) for biliopancreatic malignancy .
    Lacto-N-fucopentaose II
  • HY-N11455
    Lacto-N-difucohexaose I

    LDFH I

    		 Others Metabolic Disease
    Lacto-N-difucohexaose I (LNDFH I), a linker, could be used to combine oligosaccharides containing Lewis b sugar chain to water insoluble polysaccharide .
    Lacto-N-difucohexaose I
  • HY-158459
    A2G2F2 glycan

    A2G2F2(a1-3) glycan

    		 E-Selectin Biochemical Assay Reagents Others
    A2G2F2 glycan (A2G2F2(a1-3) glycan) is a Lewis X polysaccharide containing two Lewis X epitopes and is a symmetric N-glycan. SLeX is a ligand for the cell adhesion molecule E-selectin, which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .
    A2G2F2 glycan
  • HY-E70303
    Fucosyltransferase 6

    FUT6

    		 Endogenous Metabolite Cancer
    Fucosyltransferase 6 is a fucosyltransferase that mediates the expression of the tetrasaccharide Sialyl-Lewis x (sLex, CD15s) on the surface of leukocytes. sLex participates in E-selectin-mediated leukocyte rolling and is related to the migration of leukocytes out of blood vessels .
    Fucosyltransferase 6
  • HY-107055
    RTI 336

    		Dopamine Transporter Neurological Disease
    RTI 336 is a phenyltropane analog, as well as a potent and selective dopamine transporter (DAT) inhibitor. RTI 336 inhibits addictive agent induced locomotor activity and self-administration in Lewis rats. RTI 336 exhibits inhibitory effects depending on inherent NAc DAT levels .
    RTI 336
  • HY-125443
    Lucialdehyde A

    		Others Cancer
    Lucialdehydes A is a lanostante-type triterpene aldehydes, isolated from the fruiting bodies of Ganoderma lucidum. Lucialdehydes A shows cytotoxic effects on tumor cells, including Lewis lung carcinoma (LLC), T-47D, Sarcoma 180, and Meth-A tumor cell lines .
    Lucialdehyde A
  • HY-125664
    Lucialdehyde B

    		Antibiotic Cancer
    Lucialdehyde B is a tetracyclic triterpene isolated from the substrates of Ganoderma lucidum with antiviral and cytotoxic activities. Lucialdehyde B has cytotoxic effects against Lewis lung cancer (LLC), T-47D, Sarcoma 180 and Meth-A tumor cell lines .
    Lucialdehyde B
  • HY-158457
    A2[3]G1 N-glycan

    N/A

    		 Biochemical Assay Reagents Others
    A2[3]G1 N-glycan (N/A) is a Lewis sugar. SLeX is a ligand for the cell adhesion molecule E-selectin, which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .
    A2[3]G1 N-glycan
  • HY-P4191
    Met-RANTES (human)

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    		 CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-P4191A
    Met-RANTES (human) acetate

    		CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) acetate
  • HY-B1214
    Prednisolone acetate

    Prednisolone 21-acetate

    		 Glucocorticoid Receptor Inflammation/Immunology Cancer
    Prednisolone acetate (Prednisolone 21-acetate) is an adrenocortical hormone active molecule with various pharmacological effects such as anti-inflammatory, anti-allergic, and immune suppression.
    Prednisolone acetate
  • HY-W033277
    Tetrakis(acetonitrile)palladium(II) tetrafluoroborate

    NSC 307191; Palladium(II) tetrafluoroborate tetraacetonitrile complex

    		 Drug Intermediate Endogenous Metabolite Others
    Tetrakis(acetonitrile)palladium(II) tetrafluoroborate (NSC 307191) acts as a potent Lewis acid and facilitates the formation of the 2:1 complex [Pd(1,2-bis(2′-pyridylethynyl)benzene)2](BF4)2 through the Sonogashira cross-coupling reaction.
    Tetrakis(acetonitrile)palladium(II) tetrafluoroborate
  • HY-126854
    N-Acetyllactosamine

    N-Acetyl-D-lactosamine

    		 Endogenous Metabolite Galectin Cardiovascular Disease
    N-Acetyllactosamine (N-Acetyl-D-lactosamine), a nitrogen-containing disaccharide, is a galectin-3 inhibitor, which is an important component of various oligosaccharides such as glycoproteins and sialyl Lewis X. N-Acetyllactosamine can be used as the starting material for the synthesis of various oligosaccharides. N-Acetyllactosamine has prebiotic effects .
    N-Acetyllactosamine
  • HY-122063
    FR260330

    		NO Synthase Inflammation/Immunology
    FR260330 is a selective, orally active inhibitor for inducible nitric oxide synthase (iNOS) through suppression of iNOS dimerization. FR260330 inhibits the NO accumulation in rat splenocytes and human DLD-110 cells, with IC50 of 27 and 10 nM. FR260330 ameliorates the Lipopolysaccharides (HY-D1056)-induced inflammatory diseases in rats model .
    FR260330
  • HY-171296
    p38 Kinase inhibitor 8

    		p38 MAPK JNK Inflammation/Immunology
    p38 Kinase inhibitor 8 (Compound CCLXXVIII) is the orally active inhibitor for p38β and JNK2α2 with IC50s of 6.3 nM and 53.6 nM. p38 Kinase inhibitor 8 exhibits anti-inflammatory effect in rats collagen-induced arthritis models .
    p38 Kinase inhibitor 8
  • HY-116758
    16,16-Dimethyl prostaglandin A1

    di-Me-PGA1

    		 DNA/RNA Synthesis HIV HSV Infection Cancer
    16,16-Dimethyl prostaglandin A1 (di-Me-PGA1) is a prostaglandin analog that can inhibit DNA synthesis in Lewis lung carcinoma and B 16 amelanotic melanoma cells. 16,16-Dimethyl prostaglandin A1 also inhibits viral replication in both HSV and HIV-1 infection systems .
    16,16-Dimethyl prostaglandin A1
  • HY-P991426
    MB-314

    		Transmembrane Glycoprotein IFNAR TNF Receptor Cancer
    MB-314 is a human IgG1 monoclonal antibody (mAb) targeting Lewis Y. MB-314 induces enhanced antibody-dependent cell-mediated cytotoxicity (ADCC) activity. MB-314 increases the release of IFN-γ, TNF-α, MCP-1, and IL-6. MB-314 can be used in cancer research .
    MB-314
  • HY-120638
    BMS-250749

    		Topoisomerase Cancer
    BMS-250749 is a topoisomerase I (Top I) inhibitor of the fluoroglycosyl-3,9-difluoroindolecarbazole class. BMS-250749 exhibits potent cytotoxicity and selectivity, and shows curative antitumor activity against Lewis lung cancer. BMS-250749 exhibits broad-spectrum antitumor activity superior to CPT-11 in certain preclinical xenograft models. .
    BMS-250749
  • HY-158495
    A2 glycan (G0), 2-AA labelled

    A2 N-linked oligosaccharide, 2-AA labelled

    		 Biochemical Assay Reagents Others
    A2[3]G1 & A2[6]G1 glycan (G1), 2-AB labeled Lewis sugar. SLeX is a ligand for the cell adhesion molecule E-selectin (E-selectin), which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .
    A2 glycan (G0), 2-AA labelled
  • HY-158522
    A2[3]G1 & A2[6]G1 glycan (G1), 2-AB labelled

    A2[3]G1 & A2[6]G1 N-linked oligosaccharide, 2-AB labelled

    		 Biochemical Assay Reagents Others
    A2[3]G1 & A2[6]G1 glycan (G1), 2-AB labeled Lewis sugar. SLeX is a ligand for the cell adhesion molecule E-selectin (E-selectin), which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .
    A2[3]G1 & A2[6]G1 glycan (G1), 2-AB labelled
  • HY-118488
    L 640035

    		Prostaglandin Receptor Cardiovascular Disease
    L 640035 is athromboxaneantagonist .
    L 640035
  • HY-123191
    CJ-463

    		PAI-1 Cancer
    CJ-463 is a potent and selective uPA inhibitor. CJ-463 has antitumor activity .
    CJ-463
  • HY-119110
    LY52

    		MMP Cancer
    LY52 is an MMP-2 and MMP-9 inhibitor. LY52 can significantly block the proteolytic activity of gelatinases, reducing the expression of MMP-2 and MMP-9 in SKOV3 cells, thereby inhibiting cell invasion. LY52 can also suppress the pulmonary metastasis of Lewis lung carcinoma cells in mice. LY52 may be used in cancer research .
    LY52
  • HY-126854R
    N-Acetyllactosamine (Standard)

    N-Acetyl-D-lactosamine (Standard)

    		 Reference Standards Endogenous Metabolite Galectin Others
    N-Acetyllactosamine (Standard) is the analytical standard of N-Acetyllactosamine. This product is intended for research and analytical applications. N-Acetyllactosamine (N-Acetyl-D-lactosamine), a nitrogen-containing disaccharide, is a galectin-3 inhibitor, which is an important component of various oligosaccharides such as glycoproteins and sialyl Lewis X. N-Acetyllactosamine can be used as the starting material for the synthesis of various oligosaccharides. N-Acetyllactosamine has prebiotic effects[1][2][3][4].
    N-Acetyllactosamine (Standard)
  • HY-E70284
    Keratanase II,bacillus circulans,expressed in E.coli

    		Biochemical Assay Reagents Others
    Keratanase II,bacillus circulans,expressed in E.coli has transglycosylation activity. Keratanase II,bacillus circulans,expressed in E.coli efficiently catalyzes the transglycosylation of α(2→3)-sialylated 6,6′-di-sulfo-LacNAc with two kinds of glycosyl acceptors, 6-sulfo-Lewis X and 6,6'-di-sulfo-LacNAc derivatives, providing Sialyl sulfo-hexasaccharide and Sialyl sulfo-pentasaccharide .
    Keratanase II,bacillus circulans,expressed in E.coli
  • HY-132202
    PD-1/PD-L1-IN-10

    		PD-1/PD-L1 Apoptosis Cancer
    PD-1/PD-L1-IN-10 (compound B2) is an orally active PD-1/PD-L1 inhibitor (IC50 of 2.7 nM) with potent anticancer efficacy .
    PD-1/PD-L1-IN-10
  • HY-126740
    Anguinomycin A

    		Antibiotic Fungal Infection Cancer
    Anguinomycin A is an antibiotic that exhibits good inhibitory activity against G. boninense with an MIC value of 5 µg/disk. Anguinomycin A has antitumor activity .
    Anguinomycin A
  • HY-160048
    PEG40K unconjugated/naked AX102 sodium

    		PDGFR Cancer
    PEG40K unconjugated/naked AX102 sodium is AX102 without PEG40K conjugation. AX102 is a DNA oligonucleotide aptamer for platelet-derived growth factor PDGF-B. AX102 is 34 bases in length, selectively binds platelet-derived growth factor B (PDGF-B), and causes tumor vessel regression .
    PEG40K unconjugated/naked AX102 sodium
  • HY-149814
    PDK-IN-1

    		PDHK HSP Cancer
    PDK-IN-1 (compound 7o) is a pyruvate dehydrogenase kinase (PDK) inhibitor. PDK-IN-1 shows IC50 values of 0.03 and 0.1 μM for PDK1 and HSP90, respectively. PDK-IN-1 targets PDH/PDK axis thus reducing efficiently the tumor mass .
    PDK-IN-1
  • HY-160047
    AX102 sodium

    		PDGFR Cancer
    AX102 sodium is a 34 bp length nucleotide aptamer modified at the 5' end with a 40 kDa polyethylene glycol moiety. AX102 selectively binds platelet-derived growth factor B (PDGF-B) and causes tumor vessel regression .
    AX102 sodium

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: