1. Recombinant Proteins
  2. Enzymes & Regulators
  3. XPNPEP3 Protein, Human (His)

The XPNPEP3 protein catalyzes the removal of prolyl residues from N-terminal peptides (such as Leu-Pro-Ala) and has low activity towards Ala or Ser at the P1 site. XPNPEP3 Protein, Human (His) is the recombinant human-derived XPNPEP3 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The XPNPEP3 protein catalyzes the removal of prolyl residues from N-terminal peptides (such as Leu-Pro-Ala) and has low activity towards Ala or Ser at the P1 site. XPNPEP3 Protein, Human (His) is the recombinant human-derived XPNPEP3 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Background

The XPNPEP3 protein serves a crucial role in peptide processing by catalyzing the removal of a penultimate prolyl residue from the N-termini of peptides, exemplified by substrates like Leu-Pro-Ala. Additionally, it exhibits low activity towards peptides featuring Ala or Ser at the P1 position. Beyond its peptidase function, XPNPEP3 demonstrates an intriguing role as it promotes TNFRSF1B-mediated phosphorylation of MAPK8/JNK1 and MAPK9/JNK2, indicating a potential function as an adapter protein for TNFRSF1B. Notably, this effect is independent of XPNPEP3's peptidase activity, suggesting a dual role in cellular signaling pathways. Furthermore, XPNPEP3 may play a role in inhibiting apoptotic cell death induced via TNF-TNFRSF1B signaling, underlining its involvement in cellular processes beyond peptide cleavage.

Species

Human

Source

E. coli

Tag

N-6*His;C-6*His

Accession

Q9NQH7 (M1-S507)

Gene ID
Molecular Construction
N-term
6*His
XPNPEP3 (M1-S507)
Accession # Q9NQH7
6*His
C-term
Protein Length

Full Length

Synonyms
Probable Xaa-Pro Aminopeptidase 3; X-Pro Aminopeptidase 3; Aminopeptidase P3; APP3; XPNPEP3
AA Sequence

MPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSQAS

Predicted Molecular Mass
60.2 kDa
Molecular Weight

Approximately 65 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

XPNPEP3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
XPNPEP3 Protein, Human (His)
Cat. No.:
HY-P71435
Quantity:
MCE Japan Authorized Agent: