1. Recombinant Proteins
  2. Others
  3. ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc)

ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc)

Cat. No.: HY-P72023
Handling Instructions Technical Support

The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) is the recombinant human-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-hFc, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) is the recombinant human-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-hFc, C-Myc labeled tag.

Background

The ULBP1/RAET1I protein plays a crucial role in natural killer cell cytotoxicity by acting as a ligand that binds to and activates the KLRK1/NKG2D receptor. This binding and activation mechanism highlights the significance of ULBP1/RAET1I in mediating the cytotoxic responses of natural killer cells. Moreover, it is noteworthy that ULBP1/RAET1I does not exhibit binding to beta2-microglobulin. This characteristic interaction profile underscores the specificity and selectivity of ULBP1/RAET1I in its engagement with KLRK1/NKG2D, emphasizing its pivotal role in immune responses and its potential as a therapeutic target for modulating natural killer cell activity.

Species

Human

Source

HEK293

Tag

C-hFc;C-Myc

Accession

Q9BZM6 (G26-G216)

Gene ID
Molecular Construction
N-term
ULBP1 (G26-G216)
Accession # Q9BZM6
hFc-Myc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
ALCAN-beta; NKG2D ligand 1; N2DL-1; NKG2DL1; Retinoic acid early transcript 1I;
AA Sequence

GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Molecular Weight

Approximately 52.4 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc)
Cat. No.:
HY-P72023
Quantity:
MCE Japan Authorized Agent: